KEGG   Corallococcus coralloides: COCOR_01033Help
Entry
COCOR_01033       CDS       T01780                                 

Gene name
kdsC
Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00540  Lipopolysaccharide biosynthesis
ccx01100  Metabolic pathways
Module
ccx_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    COCOR_01033 (kdsC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ccx01005]
    COCOR_01033 (kdsC)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     COCOR_01033 (kdsC)
Lipopolysaccharide biosynthesis proteins [BR:ccx01005]
 Unusual sugar
  COCOR_01033 (kdsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase HAD_2 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AFE09166
UniProt: H8MMV0
Position
complement(1244625..1245200)
Genome map
AA seq 191 aa AA seqDB search
MPTEAPSKPGKEELTSRASRVRLLVFDVDGVLTDGGLYYGDNGEVMKRFNVKDGHALVMA
RLVGLPAAILTARSSRIVEARGRELGLAAIFQGRKEKGPAFLELLAQLQIPANQCAYMGD
DLNDLDPMSLSGLSACPADAVPEVRQEADFVTTNVGGHGAARELVELCLRASGRWEDAVG
LMRSTDKRSTS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgccgacggaagcgccttccaaaccgggcaaggaagagctgacgtcccgtgcgtcgcgc
gtgcgtctgctcgtgttcgacgtggatggcgtcctcaccgacggcgggctgtactacggc
gacaacggcgaggtgatgaagcgcttcaacgtgaaggacggccatgcgctcgtcatggcc
cggctggtgggcctgcccgccgccatcctcaccgcgcgctcgtcccgcatcgtcgaagcg
cgaggccgggaattgggcctcgccgccatcttccagggccgcaaggagaagggtcccgcc
ttccttgaattgctcgcccaactccagatacccgcgaatcagtgcgcgtatatgggagac
gacctgaacgacctggaccccatgtcactctcagggctttccgcctgtccggcggatgct
gttcctgaggtgcgccaggaagcggacttcgttacgacgaacgtgggcggtcacggagcc
gcccgtgagcttgtggagctgtgcctccgtgccagtggccgttgggaagacgccgtgggt
ctgatgagaagcacagataaacgcagcacgtcgtag

DBGET integrated database retrieval system