KEGG   Corallococcus coralloides: COCOR_01611Help
Entry
COCOR_01611       CDS       T01780                                 

Definition
(GenBank) peptidase m49 family protein, dipeptidyl-peptidase III
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
ccx  Corallococcus coralloides
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccx01002]
    COCOR_01611
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     COCOR_01611
Peptidases [BR:ccx01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   COCOR_01611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: AFE04172
UniProt: H8MYG7
Position
1930726..1932912
Genome map
AA seq 728 aa AA seqDB search
MKPLLLAAVLAAAPATPQKSPAPDAGLAQAAQPSLTVPGGKFLRARSGNTAVAQMFAPGI
AELSLAEKRVAWSLTLAAHAGEDIALDQLGWKLVPTKQLLEGVWLFGRDAQSAASGFDGK
LADYLLRFYGHGGNHDSTTGQKFVPAFTAEQLAAGASRALKAGAPWTVKDEAALQAWLQD
LKPTLFDASFEPQLTSKAPPPGQDLLTASSNTAYGPGVTQKDLVGFTEKYPLNSRVVKEN
GKLVEQVFRAGTPDGKVKPGLYAKELSRVIAHLQEAMKSAEPAQKAALGKLVRYFQTGSP
KDWDAYNIAWLKVDPKVDANLGFIETYVDPRGHKGQWEGLVNYRDTAENQIMVLMGQKAQ
YFEDRLPWPEKYRRKKVSLPVAKAINLITSHPEPPAGINLPNEQHIREKYGSKSVMITNV
MDAASAVTRLPLALEFSRTAEDREQAQKYSVTARKWLVAFHEVLGHASGQVDPKLKGQSP
SVFLKEYDNTLEEARADLVALWHAFDPALAELSPDHEAIARQMYRDFLVEGLTNLRRVET
GNAFEEDHQRGHHMTVTFLEEKGVVKQVTENGRTYLTIPDYAKMREAVGELLSQLMVIKA
TGDYEGIRALVQEKGIHFDPKLRDEVARRVKAVDVPTVLLLNSPRVVPVLDAKGTLVDLK
EDTTQAFVDQHLERSLLGRLSPSEASRVAAKVAGSPDAVREAFKELGPDTAPAPTPAKKG
AAPVKSTP
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccctgctgctggctgccgtcctcgccgccgcgcccgccaccccgcagaagtcg
cccgcgcctgatgccggcctcgcgcaggccgcgcagccctccctcaccgtgcccggaggc
aagttcctccgcgcccgctccggcaacaccgccgtcgcgcagatgttcgcgccgggcatc
gcggagctgtccctggcggagaagcgcgtggcgtggtccctcaccctcgcggcgcacgcg
ggcgaggacatcgcgttggatcagctcggctggaagctggtgccgacgaagcagctgctg
gagggcgtctggctcttcggccgcgacgcgcagagcgccgcgtccggcttcgacgggaag
ctggcggactacctgctgcgcttctacgggcacggcggcaaccacgacagcaccaccggc
cagaagttcgtcccggccttcaccgcggaacagctcgcggccggtgcttcccgcgcgctc
aaggccggcgcaccctggacggtgaaggacgaggccgcgctccaggcctggctccaggac
ctgaagcccaccctcttcgacgcgagcttcgagccgcagctcacctccaaggccccgccg
ccgggtcaggacctcctcaccgcgtcctccaacaccgcctacggccccggcgtgacgcag
aaggacctggtgggcttcacggagaagtacccgctcaactcccgcgtggtgaaggagaac
gggaagctggtggagcaggtgttccgcgcgggcacgccggacggcaaggtgaagccgggg
ctgtacgcgaaggagctctcgcgcgtcatcgcgcacctccaggaggcgatgaagtccgcc
gagcccgcgcagaaggccgcgctgggcaagctggtgcgctacttccagacgggcagcccc
aaggactgggatgcgtacaacatcgcgtggctcaaggtggacccgaaggtggacgccaac
ctgggcttcatcgagacctacgtggaccctcgcggccacaagggacagtgggagggattg
gtcaactaccgcgacacggcggagaaccagatcatggtgctcatgggccagaaggcccag
tacttcgaggaccggctgccctggccggagaagtaccgccgcaagaaggtctcgctgccg
gtggccaaggccatcaacctcatcacgtcccacccggagccgcccgcgggcatcaacctg
cccaacgagcagcacatccgggagaagtacggcagcaagagcgtgatgatcaccaacgtc
atggacgccgcctccgccgtgacgcggctgcccctggcgctggagttctcccgcacggcg
gaggaccgcgagcaggcccagaagtactccgtcaccgcgcgcaagtggctggtggccttc
catgaggtgctgggccacgcctccggccaggtggacccgaagctcaagggccagtccccg
tccgtcttcctcaaggagtacgacaacacgctggaggaggcgcgcgcggacctggtcgcg
ctgtggcacgcgttcgacccggcgctcgcggagctgtcgccggaccacgaggccatcgcc
cggcagatgtaccgggacttcctggtggaggggctcaccaacctgcgccgcgtggagacg
ggcaacgccttcgaggaggaccaccagcgcggccaccacatgacggtgacgttcctggag
gagaagggcgtggtgaagcaggtcacggaaaacggccgcacgtacctcacgattccggac
tacgcgaagatgcgcgaggccgtgggcgagctgctctcccagctgatggtcatcaaggcc
accggcgactacgagggcatccgcgcgctggtgcaggagaagggcatccacttcgacccg
aagctgcgcgacgaggtcgcccgccgggtgaaggccgtggacgtgcccacggtgctgctg
ctcaattcgccgcgcgtggtgccggtgctggacgcgaaggggacgctggtggacctgaag
gaggacaccacccaggccttcgtggatcagcacctggagcgcagcctgctgggccggctg
tcgccctcggaggccagccgcgtcgcggcgaaggtggcgggctcgccggacgcggtgcgc
gaggccttcaaggagctggggcccgacacggctccggcgccgacccccgcgaagaagggt
gcggcgccggtgaagtccacgccctga

DBGET integrated database retrieval system