KEGG   Corallococcus coralloides: COCOR_02169Help
Entry
COCOR_02169       CDS       T01780                                 

Gene name
fadA1
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00071  Fatty acid degradation
ccx00072  Synthesis and degradation of ketone bodies
ccx00280  Valine, leucine and isoleucine degradation
ccx00310  Lysine degradation
ccx00362  Benzoate degradation
ccx00380  Tryptophan metabolism
ccx00620  Pyruvate metabolism
ccx00630  Glyoxylate and dicarboxylate metabolism
ccx00640  Propanoate metabolism
ccx00650  Butanoate metabolism
ccx00900  Terpenoid backbone biosynthesis
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01120  Microbial metabolism in diverse environments
ccx01130  Biosynthesis of antibiotics
ccx01200  Carbon metabolism
ccx01212  Fatty acid metabolism
ccx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    COCOR_02169 (fadA1)
   00630 Glyoxylate and dicarboxylate metabolism
    COCOR_02169 (fadA1)
   00640 Propanoate metabolism
    COCOR_02169 (fadA1)
   00650 Butanoate metabolism
    COCOR_02169 (fadA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    COCOR_02169 (fadA1)
   00072 Synthesis and degradation of ketone bodies
    COCOR_02169 (fadA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COCOR_02169 (fadA1)
   00310 Lysine degradation
    COCOR_02169 (fadA1)
   00380 Tryptophan metabolism
    COCOR_02169 (fadA1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    COCOR_02169 (fadA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    COCOR_02169 (fadA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    COCOR_02169 (fadA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccx04147]
    COCOR_02169 (fadA1)
Enzymes [BR:ccx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     COCOR_02169 (fadA1)
Exosome [BR:ccx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCOR_02169 (fadA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFE08724
UniProt: H8MKC0
Position
complement(2608852..2610063)
Genome map
AA seq 403 aa AA seqDB search
MSQEAFIFDAVRTPRGKGKKGALHGTKPVSLLVGLVDALKQRHPNLDPKHIDDVVLGVVS
PVGDQGADIARTLVLAAGLPETTGGVQLNRFCASGLTAVNMAAQQVRSGWEHLVIAGGVE
SMSRVPMGSDGGAWAMDPATNYDTYFVPQGISADLIATMEGFTREDVDRYAVRSQERAAH
AWKNGYFQKSVVPVVDQNGLTILDRDEHMRPDSTVASLGQLSASFTTMGEMGGFDAVALQ
KYHAVERINHVHTPGNSSGIVDGAALVLVGSEKVGKTLGLKPRARIAAVATSGAEPTIML
TGPLPATRKLLDIAGLSVKDIDLFELNEAFASVVLKYQKDLDIPDEKLNVNGGAIAMGHP
LGATGAMILGTVVDELERRNARRAVVTLCVGGGMGVATLVERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaggaagcattcatcttcgacgccgtccgtacccctcgcggcaagggcaagaag
ggcgccctgcacggcaccaagccggtgtcgctgctcgtcggcctggtggacgcgctcaag
cagcgccacccgaacctggacccgaagcacatcgacgacgtggtgctgggcgtcgtgtcc
cccgtgggtgaccagggcgcggacatcgcgcgcacgctggtgctggccgcgggcctgccg
gagaccaccggcggcgtgcagctcaaccgcttctgtgcctccggcctgacggcggtgaac
atggccgcgcagcaggtgcgctccggctgggagcacctggtcatcgcgggcggcgtggag
agcatgtcccgcgtccccatgggctccgacggcggcgcgtgggccatggaccccgccacc
aactacgacacctacttcgtgccccagggcatctccgcggacctcatcgcgacgatggag
ggcttcacccgcgaggacgtggaccgctacgccgtgcgctcgcaggagcgcgcggcccac
gcgtggaagaacggctacttccagaagtccgtcgtccccgtggtggaccagaacgggctc
accatcctggaccgcgatgagcacatgcgtccggactccaccgtggcctcgctgggccag
ctgagcgcgtccttcacgaccatgggtgagatgggcggcttcgacgcggtggcgctccag
aagtaccacgcggtggagcgcatcaaccacgtgcacacgccgggcaactcctccggcatc
gtggacggcgcggcgctggtgctggtgggctcggagaaggtgggcaagacgctgggcctc
aagccgcgcgcgcgcatcgccgccgtggccacgtccggcgcggagcccaccatcatgctc
accggtccgctgccggccacccgcaagctgctggacatcgccggcctgtcggtgaaggac
atcgacctcttcgagctcaacgaggccttcgcctccgtggtcctcaagtaccagaaggac
ctggacatcccggacgagaagctcaacgtcaacggcggcgccatcgccatggggcacccg
ctgggtgccaccggcgccatgatccttggaaccgtggtggatgaactggagcggcgcaac
gcgcgccgcgcggtcgtcaccctgtgcgtcggcggcggaatgggtgtggccaccctcgtc
gagcgcgtctga

DBGET integrated database retrieval system