KEGG   Corallococcus coralloides: COCOR_02370Help
Entry
COCOR_02370       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flp_Fap Class_IIIsignal
Motif
Other DBs
NCBI-ProteinID: AFE04616
UniProt: H8MN71
Position
2879995..2880258
Genome map
AA seq 87 aa AA seqDB search
MNAIAKAPKKQFRKNRGQGMTEYIIIVALIAIAAIGVITLFGDNIRKLFGASAAALAGED
NVANDGQIATDALKKKTMKNFGQNNTY
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgatcgcgaaggccccgaagaagcagttccgcaagaaccgtggtcagggcatg
accgagtacatcatcatcgttgccctcatcgcgatcgccgccatcggcgtcatcaccctg
ttcggcgacaacatccgcaagctgttcggcgcctccgcggcggcgctggccggtgaggac
aacgtcgcgaacgacggccagatcgcgaccgacgcgctgaagaagaagacgatgaagaac
ttcggccagaacaacacctactga

DBGET integrated database retrieval system