KEGG   Corallococcus coralloides: COCOR_02371Help
Entry
COCOR_02371       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFE04617
UniProt: H8MN72
Position
complement(2880348..2881520)
Genome map
AA seq 390 aa AA seqDB search
MTPLSPGVATATEQDTPAAPGSLRFRRLWLFSPRADLAILGIPLALTGVAAVASAFLAPS
AADNAHRLLGWTAQNLLGNATHVILTFLLFGVHRDVLTAAPHQPRNILAGTLAMLGVGAA
LFFTFYADRSIHTFAVAVIFNVFGMHHTLSQHRGLWSLHGLRGGQEGLSPPSPLERKLQQ
LYVPLLLTVLLTRIFFVAESAAPGAAPYLDVGQGAVLPWQTLPLLIAVWLGYFLLLFRSV
LRSGTASGPKVLYLLGMATATGLALVAPSWGYVMLPGMHGLEYYVLSARMLEPREGDAPR
LGQKLIWPAMVVSMLPLFALGVVHGFLLDGPMRGSLGIGGGAQAHPLLRAFTSLGFACVL
AHYFADAFIFRFRIPSIRKVMLRRLGFSTP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgctgagccccggagtcgccaccgccacggagcaggacacgccggccgcgccc
ggctccctgcgctttcgccgcctgtggctgttctccccccgggccgacctcgccatcctg
ggcatccccctggccctgaccggggtggccgccgtcgccagcgcgttcctcgccccttcc
gccgcggacaacgcccaccggctcctgggatggacggcccagaacctcctgggcaatgcc
acacacgtcatcctcacgttcctgctcttcggcgtgcaccgcgacgtgctcaccgccgca
ccccaccagccgcgaaacatcctggccggcacgctggccatgctcggcgtgggcgcggcg
ctgttcttcaccttctacgccgatcgctccatccacaccttcgccgtggccgtcatcttc
aacgtcttcggcatgcaccacacgctgtcgcagcaccggggcctgtggtccctgcacggc
ctgcgcggcggacaggagggcctctccccgccctcaccgctcgagcgcaagctccagcag
ctctacgtcccgctgctcctcaccgtcctcctcacccgcatcttcttcgtcgccgagtcc
gccgctccgggcgccgccccctacctcgacgtgggccagggcgcagtcctcccgtggcag
acgctgcccctgctcatcgccgtctggctgggctacttcctcctgctcttccgcagcgtg
ctccgctccggcaccgccagcggccccaaggtgctgtacctcctgggcatggcgaccgcg
accggcctggcgctcgtggcgccgtcctggggctacgtgatgctcccgggcatgcacggc
ctggagtactacgtcctcagcgcccgcatgctggagcctcgcgagggcgatgctccccgc
ctgggacagaaactcatctggcccgccatggtcgtgtccatgctcccgctgttcgcgctg
ggcgtggtgcatggcttcctgctggatggccccatgcgcggctcgctgggcatcggcggc
ggcgcgcaggcgcatcccctgctgcgtgcgttcacctcgctgggcttcgcgtgcgtgctc
gcgcactacttcgcggacgccttcatcttccgcttccgcatcccctccatccgcaaggtg
atgctgcgccgcctgggcttctccaccccctga

DBGET integrated database retrieval system