KEGG   Corallococcus coralloides: COCOR_02372Help
Entry
COCOR_02372       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SmpA_OmlA DUF2845
Motif
Other DBs
NCBI-ProteinID: AFE04618
UniProt: H8MN73
Position
2881609..2882064
Genome map
AA seq 151 aa AA seqDB search
MDTPEAPVLFRASLGRPQAWWDRLFLGLVSTVAALFYAGFGVPWSGSHLAPGLTEEKVRS
VSSGMSEDEVIQRLGMPLAREVSPSGRLYWNYAKPVEKVRQYPKVYVSFESGRVFAVEVE
LKTFWGVDEEVLYLRTAERIIERPDLDDVLP
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggacacgccagaggcacccgttctgtttcgcgcttcgctgggaagaccccaggcctgg
tgggaccggctcttcctgggcctggtgtcgacggtcgcagcgctgttctacgccggcttc
ggagtcccctggtccggaagccatctggcgccgggactcaccgaggagaaggtccgctcc
gtatcgtcggggatgtccgaagatgaggtgattcaacgcctgggcatgcccctggcgcgg
gaggtgagtccatccgggaggctctattggaactacgcgaagccggttgagaaggtccgg
cagtatccgaaggtctacgtctccttcgagtcaggacgcgtcttcgcggtcgaggtggaa
ctcaagaccttctggggtgtcgatgaggaggtcctctatctgcgcactgctgagcgcatc
attgaaaggcctgacctcgatgacgtccttccttga

DBGET integrated database retrieval system