KEGG   Corallococcus coralloides: COCOR_02374Help
Entry
COCOR_02374       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectate_lyase22
Motif
Other DBs
NCBI-ProteinID: AFE04620
UniProt: H8MN75
Position
2882423..2882770
Genome map
AA seq 115 aa AA seqDB search
MWTLAAILLIGVAMVAIASYLMGRTRIVLVNETGRELRVLTARIPGEQCVFEKVPVHGRV
VCQGRANGDGDLFIDLEFTDGSKVQLGTGAFVNPLFGLRGVATVNADGGVSLEWD
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
gtgtggacgctggcggcaattttgctgatcggcgtggcgatggttgcgattgccagctat
ctgatgggaagaacgcgcattgtcctcgtgaacgaaaccggaagggagctgcgtgtcctg
acggctcggattcctggcgagcaatgtgtttttgagaaggtcccggttcatggccgtgtc
gtctgtcagggacgcgcgaacggggatggggacctgttcattgaccttgagttcacggat
ggcagcaaggtccagttgggaaccggtgcgttcgtgaatccgctgttcggattgcgagga
gtcgccaccgtgaacgcggacggtggagtcagcctggagtgggactga

DBGET integrated database retrieval system