KEGG   Corallococcus coralloides: COCOR_02378Help
Entry
COCOR_02378       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Antimicrobial20
Motif
Other DBs
NCBI-ProteinID: AFE04624
UniProt: H8MN79
Position
2884468..2884935
Genome map
AA seq 155 aa AA seqDB search
MRKDWTWPTEALAGVVSGLELLGPELSQELRDQWWQTFLPGLSTSGPFYSFIFDFAKKVQ
VKIALKAEVHYSRQQQGGVFHVVSEPLLPVLRIEAASPPPLNILEAMVWEPPRLGSPGWC
AICPESMEWSMVVAHDGPFFLKPAPCMDPPFEDSP
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagattggacctggcctactgaggcattggccggcgttgtttcgggcctggag
ttgctcggcccggagttgtcgcaggaactgcgcgaccaatggtggcagaccttcctgcct
ggattgtccacgtcagggccattttattctttcatttttgacttcgccaagaaggtccag
gtgaagatcgctctgaaggcagaggtgcactactcgcggcagcagcagggcggtgtattc
cacgtcgtgtccgagcccttgcttccggtccttcgcatcgaggctgcgtcacccccgccc
ctgaacatcctggaggcaatggtctgggagcctccgagactcggatcccctgggtggtgc
gccatctgccccgagtccatggagtggtccatggtcgtggcgcatgacggcccgttcttc
ctgaaacccgcgccctgcatggatccgcccttcgaggactctccgtag

DBGET integrated database retrieval system