KEGG   Corallococcus coralloides: COCOR_02379Help
Entry
COCOR_02379       CDS       T01780                                 

Gene name
mtaD1
Definition
(GenBank) amidohydrolase domain-containing protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AFE09511
UniProt: H8MN80
Position
2884982..2886310
Genome map
AA seq 442 aa AA seqDB search
MEGRLLLKNCAVFRADGRVRHGMAVVVEEGIIRRVAPDAEVPVLPGDWEVACRGRLVAPG
LVDCHSHMVNGQLLPPNGDFLLRQPRSRLERMRSVANLLTAEDVEVLARFASARALLDGV
SLVVDHLSCPTDVAGGLEAQARAANALGIRLVTSHSTHSLDGADVANAQADANADFVRRY
REHPRVRGALGFHASYTCEDALLSRIAGLRKELNAAVVFHLAENEDDLSTTYATHGRRVV
PRLDALGLLGPHAIAGYPRAVERSESERLAASGTFIALTPRATRSMDRAAESADGALSSL
HLVGLGTGGHGTLQEELAGALVSMLSLARSGRMPDLDDSLAHLFVSGPAELCTRLYGKPS
GGVEEGSIADLVVYDAIPAADPETGYSPFLLGQLTAARVAWTIVDGRVCVREGQLLGSDF
VDLARDAAAALGRVWSRARLGS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggaaggccgactgcttctgaagaactgcgccgtgttccgtgcggacggtcgcgtccgc
cacggcatggccgtcgtggtcgaagagggcatcatccgccgcgtcgccccggacgccgag
gtgcccgtgctccccggtgactgggaagtggcctgtcgaggccgcctcgtcgcccccggg
ctcgtggactgtcactcgcacatggtcaacgggcagctcttgccccccaatggcgacttc
ctcctgcgccagccccgctcgcgcctggagcgcatgcgttcggtggccaacctcctcacc
gccgaggacgtggaggtcctggcccgcttcgcctccgcccgcgcgctgctcgatggcgtc
agcctcgtcgtggaccacctgtcgtgccccaccgacgtcgccggtggcctggaggcccag
gcccgcgccgcgaacgcgctgggcattcgactcgtcacgtcccactccacgcacagcctg
gatggcgcggatgtggccaacgcccaggcggacgccaacgcagacttcgtccgccgctac
cgcgaacacccccgcgtccgtggcgcgctcggcttccatgcgtcctacacctgcgaggat
gccctcctttcccgcatcgcggggctgcgcaaggagctgaacgccgccgtcgtgttccac
ctggcggagaacgaggacgacctctccaccacctacgccacgcacggccgccgcgtcgtg
ccgcgcctggacgcgctgggcctcttgggcccccacgccatcgccggctacccgcgcgcc
gtggagcgctccgagtccgagcggctggccgcctccggcaccttcatcgccctcacaccc
cgcgccacccgctccatggaccgcgcggccgagtccgccgacggcgcgctgtccagcctc
cacctcgtgggcctgggcaccggcggccatggcaccctccaggaggagctggccggggcg
ctcgtcagcatgctgtccctggcgcgctccgggcgcatgccggacctggatgactcgctg
gcgcacctgttcgtcagcggccccgcggagctgtgcacccgcctgtacggcaagccgtcg
ggcggcgtggaggagggcagcatcgcggacctcgtcgtctacgacgccatccccgccgcg
gacccggagacgggctactcgcccttcctcctggggcagctgaccgccgcccgcgtggcg
tggaccatcgtggatggccgcgtctgcgtccgcgagggacagctgctgggcagcgacttc
gtggacctggcccgcgacgccgctgccgcgctcggccgtgtctggtcccgcgcacggctg
ggttcgtag

DBGET integrated database retrieval system