KEGG   Corallococcus coralloides: COCOR_02383Help
Entry
COCOR_02383       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PelG
Motif
Other DBs
NCBI-ProteinID: AFE04626
UniProt: H8MPD6
Position
2889414..2890124
Genome map
AA seq 236 aa AA seqDB search
MSSKPSVLEPLRVRVRRFQFIVGLGFLSLVVGAMLSVSLVLRLHARVNALPSDFLRIPVA
VVLEDLWVLAVLPVLCYGAARIVALRTWTTAVGAAVSGGVFVIALNFVRDGFEGLATGWG
FASALRIVAFVGGILLSARAIRAGRAAAEKGSAEAEAKAAARKSEYDEFLKAAEAGGARL
EQREGSAAAEAPAASQGTPAVGDSAATQAPAATAQTGDASSVGEATSSDVPKTPAA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccaagcccagtgtcctcgaacccctgcgcgtccgcgtccgccgcttccagttc
atcgtcggactgggcttcctgtcgctggtggtgggcgccatgctcagcgtgtcgctggtg
ctgcggctgcacgcgcgggtgaacgcgctgccgtccgacttcctgcgcattccggtggcg
gtggtgctggaggacctgtgggtgctcgcggtgctgccggtgctctgctacggcgccgcg
cgcatcgtcgcgctgcgcacgtggaccaccgccgtgggggccgcggtgtccggcggcgtg
ttcgtgatcgcgctcaactttgtgcgcgacggcttcgagggactcgccacgggctggggc
ttcgcgtcggcattgaggatcgtggccttcgtgggaggcatcctgctgagcgcccgggcc
atccgcgcgggccgtgccgccgccgagaagggctccgcggaagccgaggcgaaggccgcc
gcccgcaagtcggagtacgacgagttcctcaaggctgcggaagccgggggcgcgaggctg
gaacagcgcgaggggagcgccgccgccgaagctccggccgcatcccagggaacgcccgcc
gttggggattccgccgcgacgcaggcacctgccgccaccgcccagacgggcgatgcgagc
agcgtgggagaggccacctcgagcgacgtgccgaagacgcccgcggcttga

DBGET integrated database retrieval system