KEGG   Corallococcus coralloides: COCOR_02387Help
Entry
COCOR_02387       CDS       T01780                                 

Gene name
argH
Definition
(GenBank) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00220  Arginine biosynthesis
ccx00250  Alanine, aspartate and glutamate metabolism
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01130  Biosynthesis of antibiotics
ccx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCOR_02387 (argH)
   00220 Arginine biosynthesis
    COCOR_02387 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccx04147]
    COCOR_02387 (argH)
Enzymes [BR:ccx01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     COCOR_02387 (argH)
Exosome [BR:ccx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCOR_02387 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-ProteinID: AFE08084
UniProt: H8MPE0
Position
complement(2893574..2894923)
Genome map
AA seq 449 aa AA seqDB search
MAETLWGKGQPLDAAIHAFTVGDDPVVDLSLVPHDALGSAAHARMLAHVGLLAPEAATSL
VSALHALHDEARAGRFTIRPEQEDGHTALEAALVERTGEAGKRIHLARSRNDQVLLALRL
FMREELLALGARTAELAGTFLDFAEAHADLPLPGYTHLRRAMPSTFGLWGMAFAEGLLEE
LEALKGVWGRLDRCPLGAAAGFGVPLPIDREYVARLLGFSRVQRSPIDAQDSRGRHEAAL
LTWACSVAGTLEKWLWDVQLYSMDEFGFLALPDAFTTGSSIMPQKKNPDVVELARGRCRE
LRGLAHQVEAVAGGLPSSYHRDFQLLKRPTLQALTSAKALLEVLSRLVPALKVNAEKARA
ACDDTLYAAHHAYALVAKGQPFRDAYREVGRQLNDGSFQPDRGALTATHLGGAGNLGLAT
AREELADARDWLTRTHAQQAQAASRVWAP
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagacattgtggggcaagggccagccgctggacgcggccatccacgccttcacc
gtgggcgacgaccccgtggtggacctgtcgctcgttccgcacgacgcgctgggcagcgcc
gcgcacgcgcgcatgctcgcgcacgtggggctgctcgcgccggaggccgccacgtcactc
gtgagcgccctgcacgcgctccacgacgaggcgcgcgcgggccgcttcaccatccgcccg
gagcaggaggacggccacaccgcgctggaggccgcgctcgtggagcgcaccggcgaggcg
ggcaagcgcatccacctggcgcgctcgcgcaacgaccaggtgctgctggccctgcgcctg
ttcatgcgcgaggagctgctcgcgctgggcgcgcgcacggcggagctcgccggcacgttc
ctggacttcgcggaagcgcatgcggacctgcccctgcccggctacacgcacctgcgccgc
gcgatgccgtccaccttcggcctgtggggcatggcgttcgccgaaggactgctggaggag
ctggaggcgctgaagggcgtgtgggggcggctcgaccgctgcccgctgggcgccgccgcg
ggctttggtgttccgctgcccatcgaccgtgaatatgtcgcgcggttgctcggttttagt
cgcgttcaacgcagccccatcgacgcgcaggacagtcgggggcggcatgaagcggcgctg
ctcacctgggcgtgctcggtggcgggcactctggagaagtggctttgggacgtgcagctc
tacagcatggacgagttcggcttcctggccctgccggatgccttcacgaccggctcgtcc
atcatgccgcagaagaagaacccggacgtggtggagctggcccggggccgctgccgcgag
ctgcgcggccttgcgcaccaggtggaggcggtggccggcgggcttccctccagctaccac
cgtgacttccagctgctgaagcgccccaccctccaggccctcaccagcgcgaaggcgctg
ttggaggtgctctcgcggctggtgcccgcgctgaaggtgaacgcggagaaggcgcgcgcg
gcgtgcgacgacacgctctacgccgcgcaccacgcctacgcgctcgtggcgaagggccag
cccttccgcgacgcgtaccgggaggtgggccgtcagctcaacgacggcagcttccagccg
gaccgcggcgcgctgacggccacccacctgggtggcgccggaaacctgggcctcgccacc
gcgcgcgaggaactggcggatgcgcgcgactggctcacgcgcacccacgcacagcaggcc
caggccgcctctcgcgtctgggccccctga

DBGET integrated database retrieval system