KEGG   Corallococcus coralloides: COCOR_02395Help
Entry
COCOR_02395       CDS       T01780                                 

Gene name
sps1A
Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ccx  Corallococcus coralloides
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccx01001]
    COCOR_02395 (sps1A)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     COCOR_02395 (sps1A)
Protein kinases [BR:ccx01001]
 Serine/threonine kinases: Other
  Bacterial family
   COCOR_02395 (sps1A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase TPR_12 Pkinase_Tyr TPR_10 APH zf-HC2 Haspin_kinase TPR_MalT Kinase-like Kdo DUF3813 UBA_4
Motif
Other DBs
NCBI-ProteinID: AFE10401
UniProt: H8MPE8
Position
2900908..2904036
Genome map
AA seq 1042 aa AA seqDB search
MPESTAHLDEVELLDLADGIPSQSLRERAEAHLDACASCRESLAEFLRVRAVPAPDVHAA
RTAVMLSDPLTRSVKPRIPQVAQGTLLGRYVVLERLGAGGMGVVHAAYDPSLDRRIGLKL
LRAPPSAGGSQGGTERLLREAQAAARTRHPHVVAVHDVGTFGDVVFIAMELVDGGTLRQH
LREATRPWRDVVRLYLQAGRGLAAAHAAGVVHRDFKPDNVLVDKEGRARVTDFGLARLES
PDDVGPAAAIPALPPGDATPPKGAPLVTSVAGTPGYIAPEVLTGSPADARSDQYAFCVSL
YEGLHGQKPSASESGGLANRSNVPRAVHTLVVRGLSADPAARHPSMPVLLDALERAAFPR
TSAKMAAAGVGVGLLAIAAAVVVTRSPSPCADDPTRLQGIWDADRKAALLKAFQATGAPD
AVATYETTARTLDAYASGWNDSRRDACLATHEHGTQSTAMLDLRTHCLERRRRELTALTE
VLFSADRVGVASAPEAAQALSPLSRCADVEALSQPVPPPERPEVAARVKAAYAKLDDARA
RLNADRWQDAVDRVAPIVKEAEGLGYKPLLGEALLIEGEARAFLRDESAEPALRRAMLAS
LSGRDDLRAAEAVVYQVFVDGEVTQRPEQAKAHADEARALLERSGGNLELESQLLAYEGN
SLEQQSRSSEALPVIQQALALQERLHGRDSPRLARALLTMASTQRSMGRAEDALATIRRA
KDALEKAYGPDHPKVAITINNMGGTLVELRRYEEGYAAFLETLRRYERIYGPDHQPQRYV
AGLRSNLSAAAFRMGRYEESERRMLEARAIYKQLFPKGSVFRIRSGTNLSQILMNQSRVA
DAQGLLQEMEEEVAAARADGRSDPIFAAVPRCQAEAWMRLGQTERAVAAAKHSVAIVREL
KGETELGESLRVLTVALTRAKKLNEARDVARELLALHHKLAGEETRPPMEMEEMMAELSL
ARGEVDEARKWGERSLEAWSQTAAPPLEMANIRFTLARALRKSQLEPERARALATAARDA
VLPTAEPRLLKLAELDAFLREH
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagtccactgcccacctcgacgaggtcgagctgctcgacctcgcggacggcatc
ccgtcccagtccctgcgcgagcgcgcggaagcccacctggacgcctgcgcgtcatgccgc
gagtccctggcggagttcctgcgcgtgcgcgccgtgcccgcgccggacgtgcacgccgcg
cgcacggcggtgatgctgtcggatccgctgacccgctccgtcaagccgcgcatcccgcag
gtggcgcaggggacgctgctggggcgctacgtggtgttggagcggctgggcgcgggaggc
atgggcgtcgtccacgcggcgtatgatccgagcctcgaccgccgcatcggactgaagctc
ctgcgcgcgccgccctcggctggaggctctcagggcggaacggagcggctccttcgggag
gcccaggccgccgcgcgcacgcgccacccgcacgtcgtcgcggtgcacgacgtggggacg
ttcggggacgtggtcttcatcgcgatggagctggtggacggcggcacgctgcgccagcac
ctgcgggaggccacccgcccgtggcgcgacgtggtgcggctgtacctccaggcgggcagg
gggctcgcggcggcgcacgcggcgggtgtcgtgcaccgcgacttcaagccggacaacgtg
ctcgtggacaaggagggccgagcccgcgtgacggacttcggcctggcccgcctggagtcc
cccgacgacgtgggccccgccgcggccatccccgcgctgccccctggagatgccacgccg
ccgaagggcgctccgctggtcaccagtgtcgcgggtacgccggggtacatcgcgccggag
gtgctcacgggctctcctgccgacgcgcggtcggatcagtacgcgttctgtgtctcgctg
tacgaagggctgcacggccagaaaccctccgcctctgagtccggcggcctggcgaaccgg
agcaatgtcccgcgcgccgtgcacacgctcgtcgtgcgcgggctgtcagcggatccggcc
gcccgccatccctccatgccggtcctgctcgacgcgctggagcgcgcggccttcccacgc
accagcgcgaagatggcggcggcgggcgtgggcgtgggcctgctcgccatcgcggcagca
gtggttgttacccggagcccctcgccctgcgcggatgaccccacgcggctccagggcatc
tgggacgcggaccgcaaggcggcgctgctcaaggccttccaggccacgggcgctccagac
gccgtcgccacctacgaaaccaccgcccggacgctggacgcctatgcctccggctggaac
gacagccgccgagatgcctgcctggccacgcacgaacacggcacgcagtccacggcgatg
ctggacctgcgaacccactgcctggagcgtcgccggcgggagctgaccgcgctcacggag
gtgctcttctccgcggaccgggtgggcgtcgccagcgctcccgaagccgcgcaggcgctg
agcccgctgtcgcgttgcgcggacgtggaggccctgtcccaacccgtgcccccgccggag
cggcccgaggtcgccgctcgcgtgaaggccgcgtacgcgaagctggacgacgcgcgggcc
cgcctgaacgcggaccggtggcaggacgccgtggaccgcgtcgcccccatcgtgaaggag
gcggagggcctgggctacaagccgctgttgggcgaagccctgctcatcgaaggcgaggcc
cgcgccttcctgcgcgacgagtccgcggaaccggcgctgcgccgcgcgatgctcgcatcc
ctgtcgggccgcgacgacctgcgcgccgcggaggccgtcgtctaccaggtcttcgtcgac
ggcgaagtgacccagcgtccggagcaggccaaggcccacgccgacgaggcccgcgcgctc
ctggagcgctccggaggcaacctggagctggagtcccagctgctcgcgtacgaaggcaac
tcactggagcagcagtcgcgctcgtcggaggcgctgcccgtgatccagcaggcgctggcg
ctccaggagcggttgcatggtcgcgactcgccacgactcgcccgcgcgctgctcacgatg
gcctccacccagcggtcgatggggcgcgcggaggatgcgctcgccaccatccggcgcgcc
aaggacgcgctggagaaggcgtacggcccggaccacccgaaggtcgccatcaccatcaac
aacatgggcggcaccctggtggagctgcggcgctacgaggagggatatgcggccttcctg
gagaccctgcgccgctacgagcgcatctacggccccgaccaccagccccagcgctacgtc
gccggcctgcggtcgaacctgagcgcggcggccttccgcatggggcgctacgaggagtcc
gagcgccgcatgctggaagcccgggccatctacaaacagctgtttcccaagggctccgtc
ttccgcatccgctcgggcaccaacctgtcccagatcctcatgaaccagagccgggtggcg
gacgcccaggggctgctccaggagatggaagaggaggtggcggcggcccgggccgatggc
cgcagcgatcccatcttcgcggcggtgccgcgatgccaggcggaagcctggatgcggctg
ggacagaccgagcgcgccgtcgcggcggcgaagcactccgtggccatcgtgcgggagctg
aagggggagaccgagctgggagaatcgctgcgagtcctgaccgtggccctcacccgcgcg
aagaagctcaacgaggcccgggacgtggcgcgcgagctgttggccctgcaccacaagctc
gcgggcgaagagacccggcctcccatggagatggaggagatgatggccgagctgtccctg
gcgcggggcgaggtggacgaagcccggaagtggggggagcgctcgctggaggcttggagc
cagacggcggccccacccctggagatggccaacatccgcttcaccctggcccgcgcgctg
cgcaagtcccaactggagccggagcgggcccgtgccctggccaccgccgcccgcgacgcc
gtgctccccaccgccgagccccggctgctcaagctcgccgaactggacgcgttcctgcgg
gagcactga

DBGET integrated database retrieval system