KEGG   Corallococcus coralloides: COCOR_02400Help
Entry
COCOR_02400       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1844
Motif
Other DBs
NCBI-ProteinID: AFE04634
UniProt: H8MPF3
Position
complement(2908986..2909297)
Genome map
AA seq 103 aa AA seqDB search
MSPSEKRGETFVMTGDASPASEESLSFSTFVVGLGSAVLIHLGGAPNPETGRLEKDLPSA
RQNLDLLAMLREKTRGNLTAEEEKLVDNLLSDLRLRYVEASRK
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgagcccttcggagaagcggggtgagaccttcgtgatgacgggggatgcgagccccgcc
tccgaggagtccctgtcgttcagcaccttcgtcgtcggactgggctccgccgtcctcatc
cacctgggtggggcgccgaacccggagacgggccgcctggagaaggacctgccttcggcc
cggcagaacctggacctcctggcgatgctccgcgagaagactcgcggcaacctcaccgcg
gaggaggagaagctggtggacaacctcctgtccgaccttcgcctgcgctacgtggaggca
agccggaagtga

DBGET integrated database retrieval system