KEGG   Corallococcus coralloides: COCOR_02401Help
Entry
COCOR_02401       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFE04635
UniProt: H8MPF4
Position
complement(2909294..2909578)
Genome map
AA seq 94 aa AA seqDB search
MAEGINPKHLDKRTAERYQRSGQVDEEAYKKHLEELPDVADKAVPIDTQMDGDIDDDFDD
EDEDDTDDDASDEDEADESDDADEPADEEDKASE
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaggcatcaacccgaagcacctcgacaagcgcaccgccgagcgctaccagcgc
agcggccaggtggacgaggaagcgtacaagaagcacctcgaggagctgccggacgtggcc
gacaaggccgttcccatcgacacgcagatggacggcgacatcgacgacgacttcgatgac
gaggacgaggacgacacggacgacgacgcctccgacgaggacgaggcggacgagtccgac
gacgccgacgagccggccgacgaagaggacaaggcgtccgaatga

DBGET integrated database retrieval system