KEGG   Corallococcus coralloides: COCOR_02404Help
Entry
COCOR_02404       CDS       T01780                                 

Gene name
thiD1
Definition
(GenBank) putative phosphomethylpyrimidine kinase
  KO
K00941  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00730  Thiamine metabolism
ccx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    COCOR_02404 (thiD1)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     COCOR_02404 (thiD1)
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     COCOR_02404 (thiD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phos_pyr_kin PfkB Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AFE10475
UniProt: H8MPF7
Position
2911113..2911853
Genome map
AA seq 246 aa AA seqDB search
MRPRVLLLAGLEPTGRAGLLADVAAVRARGGDAVAVPTAQTAQGSHTFAVVPASPRMLTA
QVTAAREWGPLHAVKWGVVPGPSQLSTARAALKGADAWWVVDPVVRSSRGQVLSRLTPRH
YLALAGPRVLVTPNLEEAAWLLGRPALGTVEDAQEAAEALCQRGFGAVLVKGGHLPEGQG
LADVLAYSGRTVVMRGRRLKRPPERRGTGCRLASALAAELGRGTGPEASVRAAREHVTGY
LRTGRD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaggccgcgcgtcctgctcctggcgggactggagcccacgggcagggccgggctcctg
gcggacgtggccgcggtgcgggcgcggggcggcgacgcggtggcggtgcccacggcccag
acggcgcagggctcgcacaccttcgcggtggtgccggcgtccccgcgcatgctcaccgcg
caggtgacggccgcgcgcgagtggggccccctgcacgcggtgaagtggggcgtggtgccc
gggccgtcgcagctgtccacggcgagggcggcgctcaagggcgcggacgcgtggtgggtg
gtggacccggtggtgcgctcctcccgggggcaggtgctgtcacggctgacgccccggcac
tacctggcgctcgcgggcccgcgcgtgctggtgacgccgaacctggaggaggccgcgtgg
ctgttgggccggcccgcgctgggcacggtggaggacgcgcaggaggcggcggaggcgctg
tgtcagcgcggcttcggcgcggtgctggtgaagggcgggcacctgccggaagggcagggg
ctggcggacgtgctggcgtactccgggcgcacggtggtgatgcgggggcgccggttgaag
cggcctcccgagcgccggggcacgggctgccggctggcgtccgcgctggcggcggagctg
ggccggggcacggggccggaggcctcggtgcgggcggcccgtgagcacgtcacgggctac
ctgcgcaccggccgggactga

DBGET integrated database retrieval system