KEGG   Corallococcus coralloides: COCOR_02405Help
Entry
COCOR_02405       CDS       T01780                                 

Gene name
dnaB
Definition
(GenBank) replicative DNA helicase
  KO
K02314  replicative DNA helicase [EC:3.6.4.12]
Organism
ccx  Corallococcus coralloides
Pathway
ccx03030  DNA replication
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    COCOR_02405 (dnaB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ccx03032]
    COCOR_02405 (dnaB)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     COCOR_02405 (dnaB)
DNA replication proteins [BR:ccx03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    COCOR_02405 (dnaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaB_C DnaB AAA_25 Rad51 ATPase AAA_24 AAA DEAD
Motif
Other DBs
NCBI-ProteinID: AFE08600
UniProt: H8MPF8
Position
complement(2911862..2913259)
Genome map
AA seq 465 aa AA seqDB search
MQNVLDGREGRRVHEDLAAERAVLGAVLADNGLITPVAEVVHADDFASPSHAQIFAAMMR
LDQQSKQVDHLTLAEELKVLGQLVAVGGPAYLMGLDQVVPLAANAVQYAHIVKDQALRRR
LANVGREIQDLASQETGELEVLLDEAERKVFLLAEKKREGDLRPVSELMEQTLDLLDKMK
TAATGVTGLSTGYIDLDNQLTGLHAGELIILAARPGIGKTSFAMNIAVHAALKENKAVGI
FSLEMPADQLLMRLLASTARVDMKKLRGGRLSPHDEEKFQEMAGALYNAPIYIDDSGGLS
PFDLRAKARRVKQKDPRLSLIVIDYLQLMHQKGKVESRQLEVAEISRALKQLAKELEVPI
IALSQLSRKVEERKGGKPMLSDLRESGSIEQDADVVMFIHRETEEDGEGGGGGGGGGGGG
GGGGGGNTVIPVELIVAKQRNGPIGSVELVFLAEYTRFESRARSE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgtcctggacggtagggaaggacggcgggtccacgaggatctcgccgcggag
cgcgcggtgctgggcgccgtgctggcggacaacgggctcatcacgcccgtggcggaggtc
gtccacgcggacgacttcgccagcccttcgcacgcgcagatcttcgccgcgatgatgcgg
ctggatcagcagagcaagcaggtggaccacctgacgctcgcggaggagctcaaggtcctc
ggccagctcgtcgcggtgggcggccccgcgtacctgatgggcctggaccaggtggtgccg
ctggcggccaacgccgtccagtacgcccacatcgtcaaggaccaggcgctgcgccggcgc
ctggccaacgtgggccgggagattcaagacctcgccagccaggagacgggcgagctggag
gtcctgctcgacgaggccgagcgcaaggtcttcctcctcgcggagaagaagcgcgaaggc
gacctgcgtccggtcagcgagctgatggagcagacgctcgacctgctggacaagatgaag
accgcggcgacgggcgtcacgggcctgtccacgggctacatcgacctggacaaccagctg
accggcctgcacgccggtgagctcatcatcctcgcggcgcgtcccggcatcggcaagacg
tccttcgccatgaacatcgcggtgcacgcggcgctgaaggagaacaaggccgtcggcatc
ttcagcctggaaatgcccgcggatcagctgctcatgcgtctgctcgcgtccaccgcgcgc
gtggacatgaagaagctgcgcggcggccggctgtccccgcacgacgaggagaagttccag
gagatggcgggcgctctctacaacgcgcccatctacatcgacgactccggcggcctgtcc
ccgttcgacctgcgcgcgaaggcgcggcgcgtgaagcagaaggacccgcgcctgtcgctc
atcgtcatcgactacctccagctgatgcaccagaagggcaaggtggagagccgccagttg
gaagtcgctgaaatctcccgcgcgctcaagcagctggccaaggagctggaggtgcccatc
atcgcgctcagccagctcagccgtaaggtggaggaacgcaagggcggcaagcccatgctc
tccgacctgcgtgagtccggctccatcgagcaggacgccgacgtggtgatgttcatccac
cgtgagacggaggaggacggcgagggaggcggaggcggaggcgggggtggtggcggagga
ggcggcggtggcggaggcaacacggtcatccccgtggagctcatcgtcgccaagcagcga
aacggccccatcgggtccgtcgagctggtgttcctcgcggagtacacgcgcttcgaaagc
cgcgcccggagcgagtag

DBGET integrated database retrieval system