KEGG   Corallococcus coralloides: COCOR_02406Help
Entry
COCOR_02406       CDS       T01780                                 

Gene name
yehT
Definition
(GenBank) DNA-binding response regulator
  KO
K02477  two-component system, LytTR family, response regulator
Organism
ccx  Corallococcus coralloides
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ccx02022]
    COCOR_02406 (yehT)
Two-component system [BR:ccx02022]
 LytTR family
  Unclassified
   COCOR_02406 (yehT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytTR Response_reg
Motif
Other DBs
NCBI-ProteinID: AFE10881
UniProt: H8MPF9
Position
complement(2913418..2914188)
Genome map
AA seq 256 aa AA seqDB search
MTVFRVLVVDDEAPARAKVKRLLTADARFTCVGEASDGTEALARIEALRPDLVVLDVQMP
GLTGFEVLEALGPDACPAVIFSTAYERFALQAFEAHAADYLLKPYDAGRFTRALDKAHAL
LSAGTHGSAALDALLATVAKARPERPLERLVVKVGEGWVPLRLDTVWRLSSEDKYVRLFT
AQGEHLVRQTLRALEERLDPTRFVRVHRSDLVNLEAVARLEPWTHGDGILVLKDGSTVIL
SRTYREAFLQQWGAAE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgttccgcgtgctggtggtggacgacgaggcgccggctcgcgcgaaggtgaag
cgcctgctgacggcagacgcgcgcttcacctgcgtgggcgaggcctcggacgggacggag
gcgctcgcgcgcatcgaagcgctgcggccggacctggtggtgctggacgtgcagatgccc
gggctcaccggcttcgaggtcctggaggcgctcgggccggacgcctgccccgcggtcatc
ttctccaccgcctatgagcgcttcgcgctccaggccttcgaggcccacgcggcggactac
ctcctcaagccctatgacgccggccgcttcacccgggcgctcgacaaggcccatgcgctc
ttgagcgcgggcacgcacggctccgccgcgctggacgccctgctcgccaccgtggcgaag
gcccgcccggaacgccccctggagcggctggtggtgaaggtgggcgaaggctgggtgccc
ctgcgcctggacaccgtgtggcgcctgtcctcggaggacaagtacgtccggctcttcacc
gcccagggagaacacctggtgcgccagacgctccgggccctggaggagcgcctggacccc
acccgcttcgtgcgcgtgcacagaagcgacctggtgaacctggaggccgtggcccggctg
gagccctggacgcatggggacggcatcctggtgctcaaggacggctccacggtgatcctc
agccgcacctaccgggaggccttcctccagcagtggggcgccgccgaatag

DBGET integrated database retrieval system