KEGG   Corallococcus coralloides: COCOR_02408Help
Entry
COCOR_02408       CDS       T01780                                 

Gene name
mdoC
Definition
(GenBank) acyltransferase family protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 Gemini_mov
Motif
Other DBs
NCBI-ProteinID: AFE09377
UniProt: H8MPG1
Position
complement(2915297..2916454)
Genome map
AA seq 385 aa AA seqDB search
MSAPPRPAAAHHPDLDWLRVLAIVVLHLFHTGMMFNTWEWHIKSPQALPVLEPVMGVLHL
VRMPLLMVISGAGTAFALRRRSLRAFTKDRAKRLLLPLVFGMFVVVPPQIYVERLFQGRI
QGSYAAFYPTVFDFVPYPAGSFSWHHLWFVAYLFVYCLLALPLFAALRTQAGGRFLAWAD
AWLSRGVNVLWLVVPLALNRVLLRDFPETHALLDDPRTFVHYGLLFLYGHLLGRCPGVWG
RLVALRHGLLAVTVAALIVELVWPWPVMPVVPAIVGGTVLIWSGLLTAMAFARHHVRTAP
AWLSHAQALSYPFYIFHQTVILCVGYLCLRLPVGPWAMLFAVLTLSFAVTLALCEGVSRV
SWLRPLFGMKPRAACPAVLTPEAVG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccaccccgccccgccgccgcgcaccaccccgacctggactggctccgcgtg
ctggccatcgtggtgctgcacctgttccacaccgggatgatgttcaacacctgggagtgg
cacatcaagagcccccaggcgctgccggtgctggagcccgtgatgggagtgctgcacctg
gtgcgcatgccgctgttgatggtcatctccggcgcgggcaccgcgttcgcgctccggcgg
cgctccttgagggcgttcacgaaggaccgggcgaagcggctgttgttgccgctggtgttc
ggcatgttcgtggtggtgccgccgcagatctacgtggagcggctgttccagggccgcatc
cagggaagctacgccgcgttctacccgacggtgttcgacttcgtgccctaccccgcgggc
agcttcagctggcaccatctgtggttcgtggcctacctgttcgtctactgcctcctggcc
ctgcccctcttcgcggcgctgcgcacgcaggccgggggacggttcctcgcgtgggcggac
gcgtggctgtcgcgaggggtgaacgtgctgtggcttgtcgtgccgctggcgctcaaccgg
gtgctcttgcgcgacttcccagagacgcacgcactgctggatgatccgcgcacgttcgtg
cactacggcctgctgttcctctacgggcacctgctgggccgctgcccgggcgtgtggggc
cggctggtggcgctgcgccacgggctcctggccgtgacggtggcggcactcatcgtggag
ctggtgtggccgtggccggtgatgccggtggtgcccgccatcgtggggggcacggtgctc
atctggagcgggctgctgacggcgatggccttcgcgcggcaccacgtgcgcacggccccc
gcgtggctttcgcacgcgcaggcgctgtcgtatccgttctacatcttccaccagacggtc
atcctctgcgtgggctacctgtgtctgcggctgccagtaggtccctgggccatgctcttc
gcggtgctcacgctgtccttcgccgtcacgctggcgctgtgcgagggcgtgtcccgcgtg
tcgtggctccggccgctcttcggcatgaagccccgggccgcgtgtccggccgtcctcacc
ccggaggccgtggggtga

DBGET integrated database retrieval system