KEGG   Corallococcus coralloides: COCOR_02409Help
Entry
COCOR_02409       CDS       T01780                                 

Gene name
rplI
Definition
(GenBank) 50S ribosomal protein L9
  KO
K02939  large subunit ribosomal protein L9
Organism
ccx  Corallococcus coralloides
Pathway
ccx03010  Ribosome
Module
ccx_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    COCOR_02409 (rplI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccx03011]
    COCOR_02409 (rplI)
Ribosome [BR:ccx03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    COCOR_02409 (rplI)
  Bacteria
    COCOR_02409 (rplI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N
Motif
Other DBs
NCBI-ProteinID: AFE10201
UniProt: H8MPG2
Position
complement(2916653..2917096)
Genome map
AA seq 147 aa AA seqDB search
MKVILREDIDNLGKSGELVTVKDGFGRNFLLPRKKAVLASEQNLRQLEHEKSVQTARNAK
LKGAADEQAKKLGAVKVTIKRKVGEQDKLFGSVTVLDIAEALAAQGQQVDRRQLHLAEPI
KSLGSYDVELRLHREVTAKIKVDVVAE
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcattctgcgtgaggacatcgacaacctcggcaagtccggcgagctcgtcacg
gtgaaggacggcttcggccgtaacttcctgctgccgcgcaagaaggcggtcctggcgagc
gagcagaacctgcgtcagctggagcacgagaagtccgtgcagacggcgcgcaacgccaag
ctgaagggcgctgccgacgagcaggccaagaagctgggcgccgtcaaggtcaccatcaag
cgcaaggtgggcgagcaggacaagctgttcggctccgtcacggtgctggacatcgccgag
gcgctcgcggcccagggccagcaggtggatcgccgccagctgcacctggccgagcccatc
aagtcgctgggcagctacgacgtggagctgcgcctgcaccgcgaggtgacggcgaagatc
aaggtcgacgtggtggccgagtag

DBGET integrated database retrieval system