KEGG   Corallococcus coralloides: COCOR_02410Help
Entry
COCOR_02410       CDS       T01780                                 

Gene name
rpsR
Definition
(GenBank) 30S ribosomal protein S18
  KO
K02963  small subunit ribosomal protein S18
Organism
ccx  Corallococcus coralloides
Pathway
ccx03010  Ribosome
Module
ccx_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    COCOR_02410 (rpsR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccx03011]
    COCOR_02410 (rpsR)
Ribosome [BR:ccx03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    COCOR_02410 (rpsR)
  Bacteria
    COCOR_02410 (rpsR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S18 Keratin_2_tail
Motif
Other DBs
NCBI-ProteinID: AFE10268
UniProt: H8MPG3
Position
complement(2917127..2917531)
Genome map
AA seq 134 aa AA seqDB search
MSNGMDSKQGAGASRGPGGGGGYGGGSRGGDRGGDRGGDRDRGGDRGDRGGMGGDDDKRG
GRGFGRKKVCRFCAEKNASVDFKDQATLKYFVTERGKIIPRRISGNCAKHQREVAVAIKR
ARGIALLPYNAVVG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacggcatggatagcaagcagggcgcgggcgcttcccgcggccccggtggcggt
ggcggctacggcggcggttcgcgcggtggcgaccgtggtggtgatcgcggcggtgaccgc
gaccgtggtggtgatcgtggcgaccgcggcggtatgggcggcgacgacgacaagcgcggt
ggccgcggcttcggccgcaagaaggtctgccggttctgcgcggagaagaacgcgtcggtg
gacttcaaggaccaggcgacgctgaagtacttcgtcaccgagcgcggcaagatcatcccc
cgccgcatctccggcaactgcgcgaagcaccagcgtgaggtggcggtggccatcaagcgc
gcccgcggcatcgcgctcctcccctacaacgcggtggtcggctag

DBGET integrated database retrieval system