KEGG   Corallococcus coralloides: COCOR_02417Help
Entry
COCOR_02417       CDS       T01780                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00240  Pyrimidine metabolism
ccx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    COCOR_02417 (tdk)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     COCOR_02417 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AFE10465
UniProt: H8MPH0
Position
2921946..2922494
Genome map
AA seq 182 aa AA seqDB search
MFSGKTEELIRRVKRALYGRQKVRVFKPRIDTRYDDTQVVSHSQLKLTSLPIERAEEIFR
HLSPDTQVVGIDEVQFLGGEVVQVCEALAQRGMRVICAGLDQDYQGRPFEPMPQLMAVAE
YVTKELAICAVCGNPANRSQRIIGSEERVVVGAAGAYEPRCRKCHVAEPAEASPPQTLKL
FD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgttctccggcaagacggaggagttgatccgccgcgtcaagcgcgcgctgtacggccgg
cagaaggtgcgcgtgttcaagccgcgcatcgacacgcgctacgacgacacgcaggtggtc
agccacagccagttgaaattgacgtccctgcccatcgaaagggctgaagaaattttccgg
cacctgtctcccgacacgcaggtggtgggcatcgacgaggtgcagttcctgggcggagag
gtggtgcaggtgtgcgaggcgctcgcccagcggggcatgcgcgtcatctgcgcgggcctg
gaccaggactaccaggggcggcccttcgagccgatgccgcagctgatggcggtggcggag
tacgtgacgaaggagctggccatctgcgcggtgtgcgggaacccggccaaccgttcgcag
cgcatcattggcagcgaggagcgggtggtggtgggcgcggcgggtgcctacgagccgcgc
tgccgcaagtgtcacgtggcggaacccgcggaggcgagccctccgcagacgctgaagctg
ttcgactga

DBGET integrated database retrieval system