KEGG   Corallococcus coralloides: COCOR_02422Help
Entry
COCOR_02422       CDS       T01780                                 

Gene name
nrdA
Definition
(GenBank) ribonucleoside-diphosphate reductase subunit alpha
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00230  Purine metabolism
ccx00240  Pyrimidine metabolism
ccx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    COCOR_02422 (nrdA)
   00240 Pyrimidine metabolism
    COCOR_02422 (nrdA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccx03400]
    COCOR_02422 (nrdA)
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     COCOR_02422 (nrdA)
DNA repair and recombination proteins [BR:ccx03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    COCOR_02422 (nrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN ATP-cone
Motif
Other DBs
NCBI-ProteinID: AFE09637
UniProt: H8MPH5
Position
complement(2926032..2928503)
Genome map
AA seq 823 aa AA seqDB search
MTVQTPFKPNAVASPPPDSATVAPATQASSAPGDFTTTMRVKKRNGTAEPVDLNKIVRAV
GKSCVGLSRVDVMRVATKTISGLYDGATTRELDSLSIQTAAALIVEEPEYARLSARLLST
FIQKEVSNQDIQSFSQSVAAGHKHGLIADRLLTFVQANARKLNAAIDPVRNDLFEYFGLR
TVYDRYLLKNPQTREVIETPQDFFLRVACALSGDNAREAIELYRLFSSLEYLPSSPTLFN
SGTRHEQLSSCFLLDSPADELDAIYKKYSDIAMLSKFSGGIGVGYHRVRARGSLIKSTNG
HSNGIVPWLKTLDASVAAVNQGGKRKGACCVYLETWHADIEDFLELRDNTGDEARRAHNL
NLANWVPDLFMRRVEADQEWSLFDPKTTPHLTDLFGDAFDKAYVAAEAQGQAVRKVKARD
LYARMMKVLAQTGNGWMTFKDISNRKSNQTGQPGNVIHLSNLCTEILEVTSQGETAVCNL
GSLNLGRMVKDGKFDFDLLRSNAMLALKQLDRVIDLNYYPIPTAADSNRRWRPVGLGLMG
LQDVFFQLRLPFDSVEARNLSKKISEEIYYAALVTSSDLAEQFGAHPSFPETRAAKGELQ
FDSWGIVPEDTLRWDALRSRIMKVGLRNSLMIAIAPTATIASIAGCYECIEPQVSNLFKR
ETLSGDFLQVNRYLVRDLQQLGLWNENTRNRIKLAEGSVQDLTELPEELRAIYRTAWEIP
MRSLLDMGADRGAFIDQSQSLNLFVETPNIGKLSSMYFYAWQKGLKTTYYLRSRPATRIA
KATVGQGGPTITAAPTPAPQTVTAEAEAVACSLENPEACEACQ
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtccagacgcccttcaagccgaacgccgtcgcttcgccgccccccgactccgcc
accgtggcgcccgccacgcaggcctcgtcggcccccggcgacttcaccaccaccatgcgg
gtgaagaagcgcaacggcacggcggagccggtggacctgaacaagatcgtccgcgcggtg
ggcaagtcgtgcgtgggcctgtcgcgcgtggacgtgatgcgcgtggccaccaagaccatc
agcggcctgtatgacggcgccaccacgcgggagctggacagcctgtccatccagaccgcc
gcggcgctcatcgtggaggagcccgagtacgcccggctctccgcgcgcctgctgtccacc
ttcatccagaaggaggtcagcaaccaggacatccagtccttcagccagtccgtcgccgcc
ggccacaagcacggcctcatcgcggaccgcctgctcaccttcgtccaggccaacgcgcgc
aagctcaacgccgccatcgacccggtccgcaacgacctgttcgagtacttcggcctgcgc
accgtctacgaccgctacctgctcaagaacccgcagacgcgcgaagtcattgagacgccg
caggacttcttcctgcgcgtggcgtgcgccctgtccggcgacaacgcgcgcgaggccatc
gagctctaccgcctgttcagctcgctggagtacctgccttcctcccccaccctcttcaac
tccggcacgcgccacgagcagctctccagctgcttcctcctggactcgccggcggacgaa
ctggacgccatctacaagaagtactcggacatcgcgatgctgtcgaagttcagcggcggc
atcggcgtggggtaccaccgcgtgcgcgcgcgcggctcgctgatcaagtccaccaacggc
cactccaacggcatcgtcccgtggctcaagacgctggacgcgtccgtggcggcggtgaac
cagggcggcaagcgcaagggcgcgtgctgcgtgtacctggagacgtggcacgcggacatc
gaggacttcctcgagctgcgcgacaacaccggtgacgaggcccgccgcgcgcacaacctg
aacctggccaactgggtgccggacctcttcatgcgccgcgtggaggccgaccaggagtgg
agcctcttcgacccgaagacgacgccccacctcaccgacctcttcggtgacgccttcgac
aaggcctacgtggcggcggaagcgcagggccaggccgtgcgcaaggtgaaggcgcgcgac
ctgtacgcgcggatgatgaaggtgctggcccagacgggcaacggctggatgaccttcaag
gacatctccaaccgcaagagcaaccagacgggccagcccggcaacgtcatccacctgtcc
aacctgtgcaccgagatcctggaggtcacgagccagggtgagacggcggtgtgcaacctg
ggttcgctcaacctgggccgcatggtgaaggacgggaagttcgacttcgacctcctgcgc
tccaacgcgatgctcgcgctcaagcagttggaccgcgtcatcgacctcaactactacccc
atccccaccgccgcggactccaaccgccgctggcgcccggtgggcctgggcctgatgggc
ctccaggacgtcttcttccagctgcgcctgcccttcgactccgtggaggcgcgcaacctg
tccaagaagatctccgaggagatctactacgcggcgctggtcacctcctccgacctggcg
gagcagttcggcgcgcacccctccttcccggagacgcgcgcggccaagggcgagctccag
ttcgacagctggggcatcgtcccggaggacacgctgcgctgggacgcgctgcgctcgcgc
atcatgaaggtgggcctgcgcaactcgctgatgatcgccatcgcgcccacggccaccatc
gcgtccatcgccggctgctacgagtgcatcgagccgcaggtgtccaacctcttcaagcgc
gagacgctgtccggtgacttcctccaggtgaaccgctacctggtgcgcgacctgcagcag
ctgggcctctggaacgagaacacccgcaaccgcatcaagctggccgaaggcagcgtgcag
gacctcacggagctgccggaggagctgcgcgccatctaccgcaccgcgtgggagatcccc
atgcgctcgctcttggacatgggcgcggaccgcggcgccttcatcgaccagagccagtcg
ctcaacctcttcgtggagacgcccaacatcgggaagctgtcctcgatgtacttctacgcg
tggcagaaggggctcaagacgacgtactacctgcgctcgcgcccggcgacccgcatcgcc
aaggccaccgtgggccagggcggcccgacgattacggccgcccccacgcccgcgccgcag
acggtgaccgcggaggcggaagcggtggcgtgctcgctggaaaaccccgaggcgtgcgag
gcgtgccagtag

DBGET integrated database retrieval system