KEGG   Corallococcus coralloides: COCOR_02423Help
Entry
COCOR_02423       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFE04638
UniProt: H8MPH6
Position
complement(2928933..2929718)
Genome map
AA seq 261 aa AA seqDB search
MTTHSPQGFGYRARRTFTRLVVFLVILGLGGGVVFLLGQLNARTFTVVQENGELVVMKGR
ALPTGAAAYRPGDPRLADAYAPLPLEGQDVTLLTQQKFTDRDDLDRALFPLLETLARPRI
ASGEPAKVERGLYYLRRAEKLSGITEEQRRSLQSMLTDVAFYQARQKLEDARRLVSEGLA
QLKLAAETENRHARAANQMLTTVGPTARDLEEALRRAVHSESAPNNTPVAPAPRQPAPSP
AGDASGTPPSAAPTSDAGAQP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccattcaccgcagggattcggctaccgggcccgccgcaccttcacccggctc
gtcgtcttcctcgtcatcctgggcctgggtggcggcgtcgtcttcctcctgggccagctc
aacgcccgcaccttcaccgtcgtgcaggagaacggcgagttggtggtgatgaagggccgc
gccctgcccaccggcgccgccgcctaccgcccgggagacccgcgcctcgcggacgcctac
gcccccctccccctggagggccaggacgtcaccctgctgacgcagcagaagttcaccgac
cgggacgacctggaccgcgccctcttccccctcctggagaccctggcccgcccgcgcatc
gcgtccggcgagcccgccaaggtggagcgcggcctctattatctgcgccgcgcggagaag
ctctccggcatcaccgaggagcagcgcaggagcctccagtccatgctcaccgacgtcgcc
ttctaccaggcgcgtcagaagctggaggacgcccgccgcctcgtgtcggaaggcctggcc
cagctcaagctcgccgcggagacggagaaccgccacgcccgcgccgccaaccagatgctg
accaccgtgggccccaccgcccgcgacctggaggaggccctgcgccgcgccgtccacagc
gagagcgccccgaacaacacccctgtagcaccggcgccccggcagcccgccccgtcaccc
gccggtgacgcgtctggaacgcctccgtcagccgccccaacctccgacgcgggcgcgcag
ccctga

DBGET integrated database retrieval system