KEGG   Corallococcus coralloides: COCOR_02424Help
Entry
COCOR_02424       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 DUF4472 Snapin_Pallidin MTS
Motif
Other DBs
NCBI-ProteinID: AFE04639
UniProt: H8MPH7
Position
2929847..2936518
Genome map
AA seq 2223 aa AA seqDB search
MGPSELLPRYIFAESLFARRRVLEVDAVASTGGESARFLVERGARTVVACDADVAAVEAA
QKAHAHPQVRYRANVYDDLEAGSFDLVLVTDLAPYVRAPELLAELARLVARQGFLVGGLR
NIAGLALPQLLEPEETVPPTYGQLLDALTAHFPHVEVATQSPVLGYQLAFERGEGLQVDG
SLVRHSEAAYFVVMAGLEPARVVDPTWVQLPPEPLAFTRGKLDEVAARAKTWEERAGRLK
EAVSKLRAEIGDREAEVVALKPALEGARHDMARLTAQLEQARGTVESARERDDLSSRLRR
RELELQVATERIADADRRLTAQRLEVEAAQRAQADAGVQVLAAQETLRLERARREETAAT
LDEARERLTQAYTEVRALQDELGSLRIDRERDRLAAERAQDSAEDRRRQAEAARERELRI
AEQYSTALAAVEHLKADLARAQESARTAGDAVPVKDAELARARRELAEAQQRMHSAEGAR
KDAEARLAEREALQRGLETELASARAAEERLRQELEGRAQSESAARALAARLEEELHAAG
LRLESLEAEQKRVESAQHVAGQRLAAAETERVRVEAALVQAIDAERGQAQARLDEALAQA
RAEADERVTNALAAAHADADSRQERALAEAREQEEARLAKALEDERAYAELALTEAREQA
EARLAQALEEARSDAAARLAQSLEEARSDADARVERALADAREAAQALEANRSDADTRVE
RALAEAREAARADADARVERAVADAAQALEAARADADARVERAVADAAQALEAARADADA
RVERALAEARADADARMAKALADAAAERAAALAEAEHRREQALTEVRATASAQRSRQLAD
VEARTEQALAEARAEAEAERAQALAEARAESEAERVRQLEEAEVRAARMLAEVRAEVEAR
AATALADARAESSGQTEQVLANVRAEAEARLAAAEARAAEALEAAVEQTRSEARDTLARE
VWEHGARLAESNQAREAAEARNTELEATLRSLRQELTDSEALAALIQEDLAREQKARASV
QAELDAAREALSNEQERAARWEALLADTQAQLLSEREQQARAQVALANLQESLDAERALR
SKLEGSESSWNEAQSALEADRLRLDAALGVARTVLEEERSQRARLEASLAQLQQDSASAL
EEERARAEASRVSAQEARAQLETDLSAARAARLSTEAAFEQTRQTLSEVQASFAEAQRTN
EAALLELRQSHAASADEVRGYVRELEEARTALAEAKQSQSALDATVRELRAELTEARRSE
VEALSSLDDARTQEARDRESRAKDETALRSELETLRAESAAQRERLTEAEQARAAVQARL
AEVEARLATETTRGTTLEQALAEAESRLAAVSSQRAELEQALADAKARHAADAARLTSLE
QSLADAESQQTTETERHASLARTLAEAEARLAAESTRRAELEAALAEAEARQAAESTRRA
ELEAALAEAEARQTAESTRRAELEAALAEAEARQIAESTRRAELEASLSEVDVRQAAEST
RRSELEATIASAESTIAAESARRSELEASLKDAEARLSTLEQALADAETRAASETSRRVG
LEASLTEVEFRLAAETSNLSALEDSLAQAEARLAEGSQSQDAARESEARAARLTESLTAR
EQELREASALRVSMEAQLEGALSRTERQQQDLDELRAQLGLKEQELTALRAETARLGAAH
QELMRLGSELQRAHAALHERSQQVGRLEAELVDASDRLAATREHAEVLVVQLETARRFAG
KATNLESALEGLRAELETARAEAARLTETVQTGNERTATLEAQLADLTTRAERERTDLEA
RLAEASAQAGTEQAELELRLTEALTSAGTDKATLELRLNEALARASMEKSELETRFNERL
ASTEAEKAELETRLNELLANAGTEKSELETRLNELLANAGTEKAELETRLNELLANAGTE
KAELETRLAETLAQAGTERAELEARLAELTEQAREEKSSIEAQLADATARAAAERAELEA
RIADLTAQADSANAERDARLSEAQARASTEQAELEARLARSAEQTREALAAMEARLATAL
EDARTEQAALESRVAALTQAAADAEAHARRADSERERLQSDLTVARAARVRLEGRTNSLE
TAAADAARLLDTERAERDQLSARIREQQARLEALETERETLVQALEEAKSATPAPPEDVL
EMAAEMEVLQAHVEKMQDQLAAREAELAELRRASSAPAAPGSARRAMPALDVPASPKKVG
ERE
NT seq 6672 nt NT seq  +upstreamnt  +downstreamnt
atggggcccagcgagctgctgccccgctacatcttcgcggagagcctgttcgcgcgccgg
cgcgtgctcgaggtcgacgccgtggcgtccacgggcggcgagagcgcgcgcttcctggtg
gagcgcggcgcgcgcaccgtggtggcgtgcgacgcggacgtggccgcggtggaggcggcg
cagaaggcccatgcgcacccgcaggttcgctaccgcgccaacgtctatgacgacctggag
gcgggaagcttcgacctggtgctggtgacggacctggcgccctacgtgcgggcgccggag
ctgttggcggagctggcgcggctggtggcgcggcagggcttcctggtgggcggcctgcgc
aacatcgcggggctggcgctgcctcagctgctggagccggaagagacggtgccgcccacg
tacgggcagctcctggacgcgctcacggcgcacttcccccatgtggaggtggccacgcag
tcgccggtgctgggctaccagctcgcgttcgagcggggcgaagggctgcaggtggacggc
tcgctcgtgcggcacagcgaggcggcgtacttcgtggtgatggcgggcctggagccggcg
cgagtggtggaccccacgtgggtgcagctgccgccggagccgctggccttcacgcgcggc
aagctggacgaggtcgcggcccgggcgaagacgtgggaggagcgggccgggcggctgaag
gaggcggtgtcgaagctccgcgcggagattggcgaccgcgaggcggaggtcgtggcgctc
aagccggcgctggagggtgcccgtcacgacatggcgcggctgaccgcgcagctggagcag
gctcggggcacggtggagtccgcgcgtgagcgggacgacctgagcagtcggctgcggcgc
cgtgagctggagttgcaggtcgcgacggagcggatcgcggatgcggaccggcggctgacg
gcgcagcgcctggaggtggaggcggcgcagcgtgcgcaggcggacgcgggcgtgcaggtg
ctggccgcgcaggagacgctgcggctggagcgggcgcggcgcgaggagacggcggcgacg
ctggacgaggctcgcgagcggctgacgcaggcgtacacggaggtgcgcgcgctgcaggat
gagctgggctcgctgcgcatcgaccgggagcgggaccggctggcggcggagcgcgcgcag
gactcggccgaggacaggcggcgtcaggcggaggcggctcgcgagcgggagctgcgcatc
gcggagcagtactcgacggcgctcgcggcggtggagcacctgaaggcggatctggcgcgc
gcgcaggagtcggcgcggacggcgggcgacgcggttccggtgaaggacgcggagctggcg
cgggcgcgccgggagctcgccgaggcccagcagcggatgcactccgccgaaggggcgcgc
aaggacgcggaggcgcggctcgcggagcgcgaggcgttgcagcgcggcctggagacggag
cttgccagcgcgcgtgcggcggaagagcggctgcggcaggagctggagggccgcgcgcag
tcggagtcggcggcccgggcgctggcggcgcggttggaggaggagcttcacgcggccggg
ctgcgcctggagtcgctggaggcggagcagaagcgggttgagtccgcgcagcacgtagcg
gggcagcggctggcggcggcggagacggagcgcgtccgcgtggaggccgcgctcgttcag
gccatcgacgcggagcggggccaggcgcaggcgcggctggacgaggcgctggcccaggct
cgggccgaggccgatgagcgggtgacgaacgcgctggccgccgcgcacgcggacgcggat
tcgcggcaggagcgcgcgctggcggaggcccgcgagcaggaggaggcgcggctcgcgaag
gcgctggaggatgaacgggcttacgcggaactcgcgctgacggaggctcgtgagcaggcg
gaggcccggctcgcgcaggcgttggaggaggcccggtccgacgcggcggcgcggctcgct
cagtcgctggaggaggcccggtccgatgcggatgcccgtgtcgagcgtgcgttggcggat
gcgcgcgaggcggctcaggcgctggaggcgaaccggtccgacgcggatacccgtgtcgag
cgtgcgctggcggaggcgcgtgaggcggctcgggccgatgcggatgcccgtgtcgaacgc
gcggtcgcggacgcggctcaggcgttggaggcggctcgggccgatgcggatgcccgtgtc
gaacgcgccgtcgcggacgcggctcaggcgctggaggcggcgcgggccgatgcggatgct
cgtgtcgagcgggctctggccgaagctcgggccgacgcggatgctcggatggcgaaggcg
ctcgcggacgccgctgctgaacgggcagcggccctggcggaggcggagcaccgacgcgag
caggcgctcaccgaggtccgtgccacggcctcggctcagcggagccggcaactggcggat
gtcgaggctcggaccgagcaggctctcgcggaagcgcgtgccgaggcggaagccgaacgg
gcccaggcgctggccgaagcccgcgccgagtccgaggccgagcgggtccggcagttggag
gaagccgaggtccgcgcggcgcggatgctcgcggaggtgcgtgccgaagtcgaagcccgc
gcggccaccgcgctcgccgacgcccgcgccgagtcgagcggccagacggagcaggtgctc
gccaacgtgcgtgcagaggcggaggcccggctcgcggcggcggaggctcgtgccgcggag
gcactcgaggccgcggtcgaacagacccgttccgaagcccgggacaccctggcccgtgaa
gtgtgggaacacggggcccggctcgcggagtcgaaccaggcgcgcgaagccgccgaggcg
aggaacacggagctggaggcaacgctccgctcgctgcggcaggagttgaccgactcggaa
gccctggcggcgctcatccaggaggacctggctcgggagcagaaggcccgggcctcggtg
caggcggagctcgacgcggctcgcgaagcgctgagcaacgagcaggagcgcgcggctcgc
tgggaggcgttgctcgccgatacgcaggcgcagctgttgtcggagcgtgagcaacaggcc
cgtgcacaggtcgcgctcgcgaacctccaggagtcgctcgacgcggagcgggccctgcgc
tccaagctggagggttcggagtcttcgtggaacgaggcgcagagcgcactggaagcggac
cggctgcggctggatgccgcgctgggcgtggcgcgcacggtccttgaggaagagcgctcg
cagcgggcccggttggaggcgtcgctcgcccagctccagcaggactccgcttcggcgctg
gaagaggagcgtgcccgggctgaagcctcgcgggtttcggctcaggaggcccgggcgcag
ctcgagacggacctgtcggcggcgcgtgccgcgcggctgtccaccgaggccgccttcgag
cagacgcgccagaccctttcggaggtccaggcttccttcgccgaagcgcagcggacgaac
gaagccgcgctgctggagctgcggcagtcgcacgcggcgtcggcggacgaggtgcgtggt
tacgtccgggagctggaagaggctcgcaccgcgctggcggaggcgaagcagtctcagtcg
gccctggatgcgacggtgcgcgagctgcgcgcggagctcaccgaggcgcggcggtccgag
gtcgaggcgttgtcctcgctcgatgatgcgcgtactcaggaggctcgcgatcgcgagtcg
cgcgcgaaggatgagactgcgctccgctcggagctggagacgctgcgcgcggagtccgcg
gctcagcgcgagcgcctgaccgaagcggagcaggcgcgggccgctgtccaggcccggctc
gcggaggtcgaagcccgcctcgcgaccgagaccacgcgtgggaccacgctggagcaggcc
ctggcggaggcggagtctcggcttgccgccgtgtcctcgcagagggccgagctggagcag
gcgctcgcggacgcgaaggcccgtcatgcagcggatgccgcacgcctgacttcgctggag
cagtccctggcggatgcggagtcccagcagaccacggagaccgagcgccatgcatcgctg
gcgcggacgctcgcggaggccgaggcccggcttgccgcggagtccacgcgccgtgctgaa
ctggaagcggcgctcgcggaggctgaggcccggcaggctgccgaatccacgcgccgtgct
gaactcgaagcggcgctcgcggaggcggaggcccggcagaccgctgagtccacgcgtcgt
gctgaactcgaagcggcgctcgcggaggctgaggcccggcagatcgctgaatccactcgc
cgtgccgaactggaagcatcgctctcggaggtcgatgtccggcaggccgcggagtccacc
cgccgctccgaactggaagcgaccatcgcctcggcggagtccacgatcgccgccgagtcc
gctcgccgttccgagctggaagcttcgttgaaggacgcggaggcccgcctctccaccctg
gagcaggcactggcggacgcggagacgcgcgccgcctccgagacttcgcgccgggtcgga
ctggaagcctccctgacggaggtcgagttccggctcgccgcggaaacttcgaacctcagc
gcgctggaggattcgctcgcgcaggcggaggcccggctcgcggagggctcgcagtcgcag
gacgcggcacgcgagtccgaagcccgggccgcgcgtctcacggagtccctgaccgcgcgc
gaacaggagctgcgcgaggccagcgccctgcgggtctccatggaagcgcaactggaaggc
gcgctctcgcggaccgagcgacagcagcaggacctggacgagctgcgcgcgcagctgggg
ctgaaggagcaggaattgacggccctgcgcgccgagacggctcgcttgggcgctgctcac
caggagttgatgcgcctgggctccgagctgcaacgggcgcacgccgcgctgcatgagcgg
agccagcaggtcggccggctggaagcggagttggtggacgccagcgaccggctcgccgcg
acgcgcgagcacgcggaagtgctcgtggtgcagctcgaaaccgcacgccgcttcgcgggc
aaggccacgaacctggagtccgcgctggaaggcctgcgcgcggaactggaaaccgcgcgc
gcggaagcagcccgtctcacggagaccgtccagaccgggaacgagcgcaccgccaccctg
gaagcacagctcgcggacctcaccactcgcgcggagcgggaacggaccgacctggaagcc
cggctcgcggaagcctccgcccaggccggcacggagcaggccgagctggagctgcgcctg
accgaagcgctcaccagcgccggcacggacaaggccaccctggagcttcgcctcaacgaa
gcgctcgcgcgagccagcatggagaagtccgagctggagacgcgcttcaacgagcgcctc
gcaagcaccgaggccgagaaggccgagctggagacgcgcctcaacgagctcctcgcgaac
gccgggaccgagaagtccgagctggagacgcgcctcaacgaactcctcgcgaacgccggg
accgagaaggctgagctggagacgcgcctcaacgagctcctcgcgaacgccgggacggag
aaggcggaactcgagacgcgcctcgccgaaacgctcgcccaggccggcacggagcgggcg
gaactcgaagcccgtctcgccgaactcaccgaacaggcccgcgaggagaagtcctccatc
gaggcccagctcgcggacgccaccgcccgcgccgcggcggagcgcgccgaactcgaggcc
cgcatcgcggacctcaccgctcaagccgactccgcgaacgcggagcgcgacgcccgtctc
tcggaagcccaggcgcgcgcctcgacggaacaggccgaactcgaagcccgcctcgcccgg
tccgccgaacagacccgcgaagccctcgccgccatggaggcccggctcgccacggcgctc
gaggacgcgcggaccgaacaggccgcgctggagtcccgcgtcgccgccctgacccaggcc
gccgccgacgccgaggcccatgcccgccgcgcggactccgagcgcgagcgcctccagtcg
gacctgacggtcgcccgcgccgcccgcgtccgcctggagggccggaccaactccctggag
accgccgccgcggatgccgcgcgcctcctggacaccgagcgcgctgaacgcgaccagctc
tccgcacggatccgcgagcagcaggcccggctggaagcgttggagaccgaacgcgaaacc
ctggtccaggccctggaggaggcgaagtccgccaccccggcgcccccggaggacgtgctg
gagatggccgcggagatggaggtcctccaggcccacgtggagaagatgcaggaccagctc
gccgcccgggaggccgaactggccgagctgcgccgcgccagcagtgcccccgctgcccct
ggctccgcgcgccgggccatgcctgccctggacgttcccgcctcacccaagaaggtcggc
gagcgcgaataa

DBGET integrated database retrieval system