KEGG   Corallococcus coralloides: COCOR_02425Help
Entry
COCOR_02425       CDS       T01780                                 

Gene name
dapF
Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00300  Lysine biosynthesis
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01120  Microbial metabolism in diverse environments
ccx01130  Biosynthesis of antibiotics
ccx01230  Biosynthesis of amino acids
Module
ccx_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    COCOR_02425 (dapF)
Enzymes [BR:ccx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     COCOR_02425 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-ProteinID: AFE08523
UniProt: H8MPH8
Position
2936543..2937394
Genome map
AA seq 283 aa AA seqDB search
MDASERIFKYHGLGNDFVVLDRRRTGVDIDAEQSRWLCDRRRGIGADGVLAILPSSRGLA
RMVVHNADGSIAEMCGNGLRCAVKYLVDHSGQHPALIDVETGAGVLTCEPGYGDGGVVGV
DISMGPARLVAANLPSGTTGQPFVGAPVPGHEGLLGTAVNMGNPHLVLLDQPLEAAERLG
PGLERHPAFPDRTNVEFVRVDEDGLTVVVWERGCGLTQACGTGACASAVAAVLAKRLPSN
AWLRVTLPGGDLRIRVPDDLSDIRLRGPVAFVFEGVVALPRAR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcaagcgaacgcatcttcaagtaccacggcctgggcaacgacttcgtcgtcctg
gaccggcgccgcaccggcgtggacatcgacgcggagcagtcccgctggctgtgcgaccgg
cgccggggcatcggcgcggacggggtgctcgccatcctcccgtcgtcccgcggccttgcc
cgcatggtcgtccacaacgccgacggcagcatcgcggagatgtgcggcaacggcctgcgc
tgtgcggtgaagtatctggtggaccactccggccagcaccccgcgctcatcgacgtggag
accggggccggcgtcctcacctgcgagcccggctacggcgatggcggcgtcgtcggcgtg
gacatctccatgggcccggcccggctggtggccgcgaacctgccctccgggacgaccggc
cagcccttcgtgggcgcccccgtgcccggccatgagggtctgctcggcaccgcggtgaac
atgggcaacccgcacctggtgctcctggaccagcccctggaggccgccgagcgcctgggc
cccggcctggagcggcaccccgccttcccggaccgcaccaacgtggagttcgtccgcgtg
gacgaggacggcctcaccgtcgtcgtctgggagcgcggctgcggcctcacccaggcctgt
gggacgggcgcgtgtgcgtccgccgtggcggccgtgctggcgaagcgcctgccctcgaat
gcctggctgcgcgtcacgctgccgggcggcgacctgagaatccgcgttccggacgacctg
tccgacatccggctccgaggccccgtggccttcgtcttcgaaggcgttgtcgcgcttcca
agggcccgatag

DBGET integrated database retrieval system