KEGG   Corallococcus coralloides: COCOR_02426Help
Entry
COCOR_02426       CDS       T01780                                 

Gene name
hnr
Definition
(GenBank) response regulator/GGDEF/GAF domain-containing protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GGDEF GAF_2 IL32 GAF
Motif
Other DBs
NCBI-ProteinID: AFE09072
UniProt: H8MPH9
Position
2937429..2939279
Genome map
AA seq 616 aa AA seqDB search
MAGPILVVDDDLFFRQLATDLLSRRGHRVVAVENATLALEEVGRATFDLVLTDVVMPGVD
GFSLTARLRERDPEQEVILVSTRDDVQGSEVALRLGVADCLVKPVEESDLLLAVDRAMER
AQLRHERARLQDENLEFARFHNLQQRCLELLSHPDLEWLQERVIADLGAVCDAQSAALWV
VDDRGDLALRSYRGLLDKQFLPEKMSPEGPLSLRLREAAPWLARDERSPVLYVPLVAAGE
VMGLAQLSDPLTGDFRLEHTRDAKVLADFAAVGVKNGRKLMALQRLGLRDRDTAAYNLSY
FTDYASKEIYKARRYGRTFSLLTFSIDNLPLVRVRLGAQDAKKAVRGIIKALSKIIRDSD
VIAKASDQEFYLLLPETDFFGAMMFVRRAVAAVRDEPDVQDVEQRLPLALVGGASTFPKD
GEDFDELVHRCRRRMDERRASLQRRLMLDGLPFWDEVDLLLGTPNSPRLPTDDRAEPSRR
GKVADVLFDELQVEIARELVRDPGSRGLLYVGGPEIRADLPLAVGLEQAPPDLSSRIYLL
GRRVDLESHAALTPVFLEGDERVARHEFILWLSESASYALIQRRGRGATWGFHTSDTAVV
DGLISKLQAEYDLQPY
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
gtggccggtcccatcctcgtcgtcgacgacgacctgttcttccgacaactcgccacggac
ctgctgtcgcgccgggggcaccgcgtggtggcggtggagaacgccaccctggccctggaa
gaggtgggccgggcgacgttcgacctggtgctcaccgacgtggtgatgcccggcgtggac
ggcttctcgctcaccgcgcgcctgcgcgaacgcgaccccgagcaggaggtcatcctcgtc
agcacgcgcgacgacgtgcagggctcggaggtcgcgctgcgcctgggcgtggcggactgc
ctcgtcaagcccgtggaggagtccgacctgctgctcgcggtggaccgcgccatggagcgc
gcccagctgcgccacgagcgcgcccggctccaggacgagaacctggagttcgcccgcttc
cacaacctccagcagcgctgcctggagctgctctcccatccggacttggagtggctccag
gagcgcgtcatcgcggacctgggcgcggtgtgtgacgcgcagagcgccgcgctgtgggtg
gtggacgaccggggagacctggcgctgcgctcctaccgggggctgctcgacaagcagttc
ctgccagagaagatgagcccggaggggccgctgtccctgcgcctgcgcgaagccgctccg
tggctcgcgcgcgatgagcgctcgccggtgctgtacgtgccgctggtggccgccggggaa
gtgatgggcctggcgcagctgtcggatccgctcaccggcgacttccgcctggagcacacg
cgcgacgcgaaggtgctggcggacttcgccgcggtgggcgtgaagaacggccgcaagttg
atggcgctccagcgcctgggcctgcgcgaccgcgacaccgccgcgtacaacctcagctac
ttcaccgactacgcgtccaaggagatctacaaggcgcgcaggtacgggcgcacgttctcg
ctcctgaccttcagcatcgacaacctgccgctggtgcgcgtgcggctgggggcgcaggac
gcgaagaaggcggtgcgcggcatcatcaaggcgctcagtaaaatcatccgcgactcggac
gtcatcgcgaaggcgagcgaccaggagttctacctcctgctgccggagacggacttcttc
ggcgcgatgatgttcgtgcgccgcgcggtcgccgccgtgcgcgacgagccggacgtgcag
gacgtggagcagcgcctgccgctcgcgctcgtgggcggtgccagcacgttccccaaggac
ggcgaggacttcgacgagctggtgcaccgctgccgccgccgcatggacgagcgccgcgcg
tcgctccagcgccggctgatgctggacgggctgccgttctgggacgaggtggacctgctg
ctgggcacgcccaacagcccgcgcctgcccacggacgaccgcgcggagcccagccgccgg
ggcaaggtggcggacgtgctcttcgacgagctccaggtggagatcgcccgggagctggtg
cgcgacccgggctcgcgcgggttgctctacgtgggcggcccggagatccgcgcggacctg
ccgctcgcggtgggcctggagcaggcgccgccggacctgtcgtcccgcatctacctgttg
ggccgccgcgtggacctggagtcgcacgcggcgctcacgccggtgttcctggaaggggat
gagcgggtggcgcgccacgagttcatcctctggctgtcggagagtgcgtcgtacgcgctc
atccagcggcgggggcggggcgcgacgtgggggttccacacctcggacaccgcggtggtg
gacgggctcatctccaagctgcaggccgaatacgacctgcagccctactga

DBGET integrated database retrieval system