KEGG   Corallococcus coralloides: COCOR_02427Help
Entry
COCOR_02427       CDS       T01780                                 

Gene name
atoC3
Definition
(GenBank) response regulator
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4388 Response_reg
Motif
Other DBs
NCBI-ProteinID: AFE08128
UniProt: H8MPI0
Position
2939304..2940803
Genome map
AA seq 499 aa AA seqDB search
MAQVRKILIADPDLDSVRALSRALRTKGYQVHYAPDGSRALEVAVLRHPDLTLFDEACRL
LDARTFVQILRTNPRTEDIPVVLTTSSLDSDRARGMRDGTLRKPFNLDEVLSRIEHIFRR
NEAAKDLKSEQQEIEGSLSQLSIPDLMQILGMNKRNGRLSLERGSERGEITVSDGRTVNA
RLGRVEGEKALFRLLAWTEGNFTFTPGTSAARPRINRAMDDALLEGMRQSDEVNRLLPGL
PPRHTRLMLAPEVDLSEEQHPVTAQVMELLRQPRALGEVLDLAPATDMEVLGVLSTLLQK
GVARPTESEGQNLGAGDLIGAAEVHALRGRLLRTRTLAKVATAKVFVCGSGSSAARRILA
RVPGLEAMSADPTAVKSGFGTLGRLELSDVLNVDFCVLPPAEAARPLWRPFSAGAIGALL
MDNSEPAVRLAHYLAWEVRIPIVVVGTEVPAPLQGAPAGVIAPGEDLTEALRAMLVQALN
PAPTLPGVTQVQRASVTPP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttggcccaggtgcggaagatcctcatcgccgaccccgacctcgactcggtgcgcgccctg
tcgcgtgcgctgcgcacgaagggctatcaggtgcactacgcgccggatggctcgcgggcg
ctggaggtcgcggtgctccggcacccggacctgacgctcttcgacgaggcgtgccggctc
ttggacgcgcgcacgttcgtgcagattctccgcaccaacccgcgcacggaagacatcccg
gtggtgctcaccacgtccagcctggactcggaccgggcgcggggcatgcgggacggcacg
ctgcgcaagcccttcaacctggatgaagtgctcagccgcatcgagcacatcttccggcgc
aacgaagcggccaaggacctcaagagcgagcagcaggaaatcgaaggttcgctcagccag
ctcagcatcccggacctcatgcagatattgggcatgaacaagcgcaacgggcgcctgtcg
ctggagcgcggttcggagcgcggggagatcaccgtctcggatgggcgcacggtgaacgcg
cggctggggagggtggaaggggagaaggcgctgttccggctgttggcgtggacggagggc
aacttcaccttcacgcccggcaccagcgccgcgcgtccgcgcatcaaccgcgccatggac
gacgcgctgttggaaggcatgcgccagtcggacgaggtgaaccgcctgttgccgggcctg
ccgccgcgccacacgcggctgatgctggcgccggaggtggacctgtccgaggagcagcac
ccggtgacagcgcaggtgatggagctgctgcgccagccacgcgcgctgggcgaggtgctg
gacctggcgcccgccacggacatggaagtgctgggcgtgctgtccacgctgctccagaag
ggcgtggcgcgccccacggagagcgaaggccagaacctgggcgcgggagacctcatcggc
gcggcggaggtgcacgcgctgcgcgggcgcctgctccgcacacgcacgctggcgaaggtg
gcgacggcgaaggtcttcgtgtgtggcagcggttcgtccgcggcgcgccgcatcctggcg
cgggtgccggggctggaggcgatgtcggcggacccgaccgcggtgaagagcggcttcggg
acgctgggacgcctggagctgagcgacgtgctgaacgtggacttctgcgtgctgccgccc
gcggaggccgcgcgtccgctgtggcgtccgttcagcgcgggggccattggcgcgctgttg
atggacaactcggagccggcggtgcggctggcgcactaccttgcctgggaggtccgcatc
cccatcgtggtggtgggcacggaggtgccggcgccgttgcagggcgctccggccggagtg
attgctccaggggaggacctcacggaggccctgcgcgccatgctggtccaggcgctcaac
cccgcgcccacgctgcccggtgtcacgcaggtgcagcgtgcttccgtgacgcccccgtga

DBGET integrated database retrieval system