KEGG   Corallococcus coralloides: COCOR_02428Help
Entry
COCOR_02428       CDS       T01780                                 

Gene name
cyc1
Definition
(GenBank) putative cytochrome P450 132
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 Peptidase_M75
Motif
Other DBs
NCBI-ProteinID: AFE08478
UniProt: H8MPI1
Position
complement(2940862..2942271)
Genome map
AA seq 469 aa AA seqDB search
MHAGHVGVLPLRPMTTATAAVTRRAPGHRGHLLMGILPDVRRDLLGCMSTLHRQYGDVVG
YRLGPQRAHLIAHPDGVKHVLQDHVKNYTKDHLTYRMVRWLTGNGLLVSTGDFWLRQRRL
AQPAFHRQRIAGMAAGMVRRTEAMLQRWEPAAASGTPLSISEEMKRLTLTIVGEALFGTS
VEDQTERVGVAFTELGKQIAERFRTFRMLPPVLPTPYDRAFRAARASLQETVRGIIATRR
ERGDDSGDLLSMLMLARDEDTGEGMTDEQLGAEVMTMLLAGHETTATALSWTWGLLSKYP
EAEARLHAELDAVLGGRAPTVEDMPRLTYTKQVLEETMRLYPSVPIFSRTVDEDDVIGGF
HIPKGTSVNLCPYVTQRHPDFWEEPDAFRPERFAPEAAAKRHRFAYFPFSGGPRMCIGSG
FTMMEAQLIVATVAQRYRLREAPGFTLEPNANLTLWPKGELPMYLERRS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcggggcatgtcggcgtgctacctttgcgcccgatgaccaccgccaccgccgcc
gtcacccgtcgggctccgggtcaccggggccacctgctcatgggcatcctgcccgacgtg
cgccgcgacctcctgggctgcatgagcacgcttcatcgccagtacggcgacgtggtgggc
taccggctgggcccccagcgcgcacacctgatcgcgcatccggacggcgtgaagcacgtg
ttgcaggaccacgtgaagaactacacgaaggaccacctcacgtaccgcatggtccggtgg
ctcaccggcaacggactgctcgtgagcacgggggacttctggctccgtcagcggcggctc
gcgcagcccgccttccaccggcagcgcatcgcgggcatggccgcgggcatggtccgtcgc
acggaggcgatgctccagcgctgggagccggccgccgcgagcgggacgcccctgagcatc
agcgaggagatgaagcggctgacgctgaccatcgtcggggaggccctcttcggcacctcc
gtggaggaccagaccgaacgggtaggcgtggccttcaccgagctgggcaagcagatcgcc
gagcgcttccgcaccttccgcatgctgccgcccgtgctgcccaccccctacgaccgcgcc
ttccgcgctgcgcgcgcctcgctgcaggaaaccgtgcggggcatcatcgccacgcggcgc
gagcgcggcgacgactcgggtgacctgctctccatgttgatgctcgcgcgtgacgaggac
acgggcgagggcatgacggacgagcagttgggggccgaggtgatgacgatgctcctcgcc
ggccatgagacgaccgccacggcgttgagctggacatggggcctgctgtcgaagtacccg
gaggccgaggcccggctgcacgcggagctggacgcggtgctgggaggacgcgcgcccacg
gtggaggacatgccgaggctcacgtacacgaagcaggtgctggaggagacgatgcggctg
tacccgtcggtgcccatcttcagccgcaccgtggacgaggacgacgtcatcggaggcttc
cacatcccgaaggggacgtcggtgaacttgtgcccctacgtcacgcagcgccatccggac
ttctgggaggagccggacgccttccgtccggagcgcttcgcccccgaggccgcggcgaag
cggcaccgcttcgcgtacttccccttcagcggcggacccaggatgtgcatcggcagcggc
ttcacgatgatggaggcgcagctcatcgtggccaccgtggcccagcgttaccgactgcgc
gaagcgcccggcttcacgctggagccgaacgcgaacctgacgctgtggcccaagggcgag
ctccccatgtacctggagcgcaggagctga

DBGET integrated database retrieval system