KEGG   Corallococcus coralloides: COCOR_02429Help
Entry
COCOR_02429       CDS       T01780                                 

Gene name
cypA4
Definition
(GenBank) cytochrome P450 family protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: AFE08490
UniProt: H8MPI2
Position
complement(2942366..2943742)
Genome map
AA seq 458 aa AA seqDB search
MTTAAATATVTRQPPGPRGHLLMGILPDVRRDILGCLGTLHREYGDVVRYRLGPMRSHLV
AHPDAVKHVLQDHVKNYTKDHLTYRMGRWITGNGLLTSTGDFWLRQRRLAQPAFHRQRIA
GMAAGMVRQTQGLLQRWETAAANGTPVGINEEMMRLTLAIVGEALFGTSVEAQAGQVGAA
FTELSQQIAERFRTFRMLPPVLPTRYDRAFRDARATLLRTVRGIITTRRERGDDTGDLLS
MLMLARDEDTGEGMTDEQLGAEVMTMLLAGHETTATSLSWVWGLLSKHPEVEARLHAELD
AVLGGHAPTVEDVPRLTYTKQVVEEAMRLYPAAVIFSRSVQEDDVIGGFRIPKGTSVDVS
PYVTQRHPDFWEEPEAFRPERFAPEAAAKRHRFAYFPFSGGPRQCIGNSFAMMEAQLVLA
TVAQRYRLREAPGFTLDPDSHLTLRPKGALPMYLERRS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgccgccgccaccgccactgtcacccgtcagcccccaggcccccggggccat
ctgctcatgggcatcctgcccgacgtgcgccgcgacatcctgggctgcctgggcaccctc
catcgcgagtacggcgacgtggtgcgctaccggctaggccccatgcgctcgcacctggtc
gcgcatccggatgccgtgaagcacgtgttgcaggaccacgtgaagaactacacgaaggac
cacctcacgtaccgcatgggccggtggatcaccggcaatggcctgctcacgagcacgggg
gacttctggctccgtcagcggcggctcgcgcagcccgccttccaccggcagcgcatcgcg
ggcatggccgcggggatggtgcggcagacgcagggactgctccagcgctgggagacggcc
gccgcgaacggcacgcccgtgggcatcaacgaggagatgatgcggctgacgttggccatc
gtcggagaggccctcttcggcacgtccgtggaagcccaggccggacaggtgggcgcggcc
ttcaccgagctgagccagcagatcgccgagcgcttccgcaccttccgcatgctgccgccc
gtgctgcccacccgctacgaccgcgccttccgcgacgcgcgcgccacgctgctgagaacc
gtgcggggcatcatcaccacacggcgagagcgcggcgacgacacgggcgacctgctctcc
atgctgatgctcgcgcgcgacgaggacacgggcgagggcatgacggacgaacaactgggg
gccgaggtgatgacgatgctcctcgccggccacgaaacgacggccacgtcgctgagctgg
gtgtggggcctgctgtcgaagcacccggaggtggaggcccggctgcacgcggagctggac
gcggtgctggggggacacgcgcccacggtggaggacgtgccgaggctcacgtacacgaag
caggtggtggaggaagcgatgcggctgtaccccgccgcggtcatcttcagccgcagcgtg
caggaggacgacgtcatcggaggcttccgcattccgaaggggacgtcggtggacgtgagc
ccctacgtcacgcagcgccatccggacttctgggaagagccggaggccttccgtccggag
cgcttcgcccccgaggccgccgcgaagcgccaccgcttcgcgtacttccctttcagcggc
gggcccaggcagtgcatcggcaacagcttcgcgatgatggaggcgcagctcgtgctggcc
accgtggcccagcgctaccgattgcgcgaagcgcccggcttcacgctggatccggattcg
cacctgacgctgcggcccaagggcgcgctccccatgtacctggagcgtcggagctga

DBGET integrated database retrieval system