KEGG   Corallococcus coralloides: COCOR_02430Help
Entry
COCOR_02430       CDS       T01780                                 

Gene name
oruR
Definition
(GenBank) AraC family transcriptional regulator
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arabinose_bd HTH_18 HTH_AraC HTH_23
Motif
Other DBs
NCBI-ProteinID: AFE09710
UniProt: H8MPI3
Position
2943875..2944903
Genome map
AA seq 342 aa AA seqDB search
MRPQTLQSSLFRPLFQVGLSLGIARERLLEAVGVDEALLARPDVRVPYAALQRVWTLLVE
VGGSEPLAVRLAQALEPTHVGLVGYVLVNSPDLRTSLQRYCRIHALLDPRTTWRVLQLPG
MMRVELELDPQDAWASRLKHPVEGLLVAMVASGRELSGEDWRPTRVCVTHPRHAASSDVE
EFLGVGIEYGASANLVQGDEAAANLPIRHADIELGNLLHARAEAELARVEAHEVRSWRER
VEEVLAAQPRTGDLIPSDVATRLAVSERTLQRRLREEGVTFAGLEDAVRRDRAFQLLRDG
QLPHFEIAFLLGFSDPSAFTRAFRRWSGMTPGQWQVSQAAKP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccccagacgctccaatcctcgctgttccgccccctgttccaggtgggcctgtcg
ctgggcatcgcccgggagcggctgctcgaagcggtaggcgtggacgaagccctgctcgcg
cggccggacgtgcgggttccctacgcggcgctccagcgcgtgtggaccctgctcgtcgag
gtgggcggctccgagccgctggccgtgcggctcgcgcaggcgctggagcccacccacgtg
gggctcgtgggctacgtgctggtcaacagccccgacctgcgcacgtccctccagcgctat
tgccgcatccacgcgctgttggatccgcgcacgacatggcgagtcctccagctgcccggg
atgatgcgcgtggagctggagctggatccgcaggatgcctgggcctcgcgcctgaagcac
cccgtggaggggctgctcgtggcgatggtggccagcggccgcgagctcagcggcgaggac
tggcgccccacgcgcgtgtgcgtcacgcatccgcgccatgctgcgtcctcggacgtggag
gagttcctcggcgtcggcatcgaatacggcgcgagcgccaacctcgtgcagggcgacgag
gccgccgcgaacctccccatccgccacgcggacatcgagctgggcaacctgctccacgcc
cgcgccgaagcggagctggcgcgggtggaggcccacgaggtccgctcctggcgcgagcgc
gtggaggaggtgctcgcggcccagccccgcacgggggacctcatcccctcggacgtggcg
acgcggctcgcggtgagtgagcgcacgctccagcgccgcctgcgggaggagggcgtcacg
ttcgcgggcctggaggacgccgtgcgccgcgaccgcgccttccagctcctgcgcgacgga
cagctgccccacttcgagatcgccttcctcctgggcttcagcgaccccagcgccttcacc
cgcgccttccgccgctggagcggaatgacgccgggacagtggcaggtgtcccaggccgcg
aagccctga

DBGET integrated database retrieval system