KEGG   Corallococcus coralloides: COCOR_02438Help
Entry
COCOR_02438       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFE04645
UniProt: H8MPJ1
Position
2952759..2953250
Genome map
AA seq 163 aa AA seqDB search
MNAPRKWSPVALVLALSLGCTTTRGGVGLHSDGTPKPEDCPEDALKTMRILRLRVGDGAN
VTLDINQDDVSPITLYEGPVESMLISSLGPLETTTRLYGRVWTGGPQVVVRYYEAHPPDG
DKIPICAVARLSKGQLRKRPDSKPGTAILEFSSAGVDIVESYR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccgcgcaagtggtccccggttgccctcgtgctggccctgtcgctgggctgc
accacgacccgagggggcgtggggcttcattcggacgggacgcccaagccggaggactgc
cccgaggatgcgctgaagacgatgcgcatcctccgcctgcgcgtgggtgacggagcgaat
gtcacgctcgacatcaatcaggacgacgtcagccccatcacgctctacgaggggcccgtg
gagagcatgctcatctccagcctcgggcctcttgaaacgaccacccgtctctacgggcgc
gtgtggaccggaggaccccaggtggtggtccggtactacgaggcgcatccacccgacggc
gacaagatccccatctgtgccgtggcgaggctctccaaggggcagttgcggaagcggcct
gactccaagcccggaacggccatcctggagttctcctcggcgggcgtcgacatcgtcgag
tcctaccgctga

DBGET integrated database retrieval system