KEGG   Corallococcus coralloides: COCOR_02442Help
Entry
COCOR_02442       CDS       T01780                                 

Gene name
yusZ1
Definition
(GenBank) dehydrogenase
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase DUF1776 RmlD_sub_bind Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: AFE11162
UniProt: H8MPJ5
Position
2956443..2957186
Genome map
AA seq 247 aa AA seqDB search
MKTVLITGCSSGYGLETARQFHAQGWNVVATMRTPREGVLPSSDRLRVVPLDVTKPESIA
AALEASGPIDVLVNNAGIGLMGAFEATPMATVREVFETNVFGVMAMTQAVLPQLRARKSG
VIVNVTSSATLAPMPLVAVYTASKVAIEGFTESLAFELEDFHLRVKLVEPGYCPSTRFTS
NGTPRMEGLFPEAYAPFAQRIFASLGQPSAVTRESDVAEAIWRAANDTSKTLRFPAGPDA
VALARSA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagacggtgctcatcacggggtgctcttctggatatggactcgagacggcacgccag
tttcacgcgcagggctggaacgtggtcgccaccatgcgaacgccgcgtgagggtgtcctt
ccttcctcggaccgcctgcgcgtggtgccgctcgacgtgacgaagccggagagcatcgcc
gccgcgctggaggcgagcgggcccatcgacgtgctcgtcaacaacgcgggcatcggactc
atgggcgccttcgaggccacgccgatggccacggtgcgcgaggtgttcgagaccaacgtc
ttcggcgtcatggcgatgacgcaggcggtgttgccacagcttcgtgcacgcaagtcgggc
gtgatcgtgaacgtgacctccagcgcgaccctggcccccatgccgctggtggccgtctac
accgcgagcaaggtggccatcgaagggttcacggagtcgctcgccttcgagctcgaggac
ttccacctgcgcgtgaagctcgtcgagccgggctattgcccgagcacccgcttcacgagc
aacggcaccccccgcatggaggggctgttccccgaggcgtacgcgcccttcgcccagcgc
atcttcgcctcgctcggacagccctccgcggtgacgcgcgagtccgacgtggccgaggcc
atctggcgagccgcgaacgacacgtcgaagacgctccgcttccccgccgggccagacgcg
gtggcgctggcccggtcggcgtga

DBGET integrated database retrieval system