KEGG   Corallococcus coralloides: COCOR_02444Help
Entry
COCOR_02444       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DrsE_2
Motif
Other DBs
NCBI-ProteinID: AFE04648
UniProt: H8MPJ7
Position
complement(2958322..2958741)
Genome map
AA seq 139 aa AA seqDB search
MSDRVSTPDNRVVVFLHSGEYDRVHQGLSIAAAATAAGRRVEVYLFWWALERFLLDRLDE
PDFAGREDVADRFEARGMPTVRALLEHVRDSGLGTVAGCTGSLGALGSESKAGDSGIDVW
LGWSAILQRTAGVADRFYL
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccgcgtgagcacgccggacaacagggtcgtcgtcttcctgcacagtggcgaa
tacgaccgggtgcaccaggggctctccatcgcggcggcggcgacagcggccggacggcgt
gtggaggtgtacctgttctggtgggccctggagcgcttcctcctggacaggttggacgaa
ccggacttcgccggccgtgaggacgtggcggaccgcttcgaggcgcggggcatgcccacc
gtgcgagcactgctcgagcacgtgcgcgactccgggctgggcacggtggcgggctgcacg
ggctcgctcggtgccctggggagcgagtcgaaggcgggcgacagtggcattgacgtctgg
ctcgggtggagcgccatccttcagcgtacggcgggcgtggcggatcgtttctatctttaa

DBGET integrated database retrieval system