KEGG   Corallococcus coralloides: COCOR_02445Help
Entry
COCOR_02445       CDS       T01780                                 

Gene name
fni
Definition
(GenBank) isopentenyl pyrophosphate isomerase
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00900  Terpenoid backbone biosynthesis
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01130  Biosynthesis of antibiotics
Module
ccx_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    COCOR_02445 (fni)
Enzymes [BR:ccx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     COCOR_02445 (fni)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_dh IMPDH Glu_synthase
Motif
Other DBs
NCBI-ProteinID: AFE08806
UniProt: H8MPJ8
Position
2958893..2959951
Genome map
AA seq 352 aa AA seqDB search
MGDETTARRKDAHLDLCATGDVEPAQNSTLLENVHLIHCAMPEMAVEDVDLSTPFLGKRL
QAPLLVTGMTGGTDRAGAVNRDLALLAERHGLAFGVGSQRAMAEHPSRAASYAVRDVAPT
VALLGNIGLYQAIGLGVDGVRRLMDAIGADGMALHLNAGQELTQPEGDRDFRGGYRVVEE
LARAMGDRLLVKETGCGIGPDVARRLVELGVRNVDVSGLGGTSWVRVEQLRAVGSQAQVG
EEFSGWGIPTAAAIASVRKAVGPEVRLVASGGVRGGLESAKVLALGADLAGMALPLFRAQ
QQGGLPAAEEALKVILTGLRQALVLTGSRTVAQLRQRPRVVTGALKDWLAAL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgagacgacagccaggcggaaggatgcccacctcgacctgtgcgcgaccggc
gatgtggaaccggcacagaactccacgttgctggagaacgtgcacctcatccactgcgcc
atgccggagatggcggtggaggacgtggacctgtccacgccgttcctgggcaagcgcctc
caggcgccgctgctcgtcaccggcatgacgggtggcacggaccgcgcgggcgcggtgaac
cgggacctggcgctgctcgcggagcggcacggcctggccttcggcgtgggcagccagcgc
gccatggcggaacacccctcgcgcgcggcgtcgtacgcggtgcgcgacgtggcgcccacg
gtggcgctcctgggcaacatcgggctgtaccaggccattggcctgggcgtggacggcgtg
cggcggttgatggacgccattggcgcggacggcatggcgctgcacctcaacgcgggccag
gagctgacgcagccggaaggcgaccgcgacttccgcggcggctaccgcgtggtggaggag
ctggcgcgcgcgatgggcgaccggctgctggtgaaggagaccgggtgcggcatcggtccg
gacgtggcgcggcgcctggtggagctgggcgtgcgcaacgtggacgtctccgggctgggc
ggcacgtcgtgggtgcgcgtggagcagcttcgcgcggtgggctcgcaggcgcaggtgggt
gaggagttcagcggctggggcatccccaccgcggcggccatcgccagcgtgcgcaaggcg
gtggggccggaggtccggctcgtggccagcggcggggttcgcggcgggctggagtccgcg
aaggtgctcgcgctgggcgcggacctggcgggcatggcgctgccgctgttccgggcccag
cagcagggcgggctgccggccgcggaggaggcgctgaaggtcatcctcacgggcctgcgc
caggcgctggtgctgacgggcagccgcaccgtcgcgcagctgcggcagcggcctcgcgtg
gtgaccggcgcgttgaaggattggttggcggcgttgtga

DBGET integrated database retrieval system