KEGG   Corallococcus coralloides: COCOR_02447Help
Entry
COCOR_02447       CDS       T01780                                 

Gene name
mvk
Definition
(GenBank) mevalonate kinase
  KO
K00869  mevalonate kinase [EC:2.7.1.36]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00900  Terpenoid backbone biosynthesis
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    COCOR_02447 (mvk)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.36  mevalonate kinase
     COCOR_02447 (mvk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFE09554
UniProt: H8MPK0
Position
2961423..2962361
Genome map
AA seq 312 aa AA seqDB search
MKPLVAFGAGKVILLGEHSVVYGYPAIAGPLSIGVVARGGPSRSCVLDVPVTADAAQKRM
MRKAFARAAKLVGEPKVKVTLEPQLPLSAGLGSSAALAVATSRVLLQAAGQEPTAKATAR
LAWEMEQEFHGTPSGVDHTTSAEEKLILYRRVQAPAGVTGRARELKSPRPVSVVVALAGA
RSPTKLTVGALRERQARWPERYKRLFGQVGRLVTEAAKTVEAGDLEGLGDAMNVNQGLLN
ALGLSSPALEDMVFRLRSLGALGAKFTGAGGDGGAVIGLFPEPEPVVAQLTRDGVRCFAS
QLAGPRVQGDIP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccctggtcgccttcggtgccggcaaggtcatcctgctgggcgagcacagcgtg
gtgtacggctaccccgccatcgccggtcccctgagcatcggcgtggtggcgcgcggtggg
ccttcgcgctcgtgcgtgctggacgtgccggtgacggcggacgcggcgcagaagcggatg
atgcgcaaggccttcgcgcgggcggcgaagctcgtgggcgagccgaaggtgaaggtcacg
ctggagccgcaattgcccctgtccgcggggctgggcagctccgcggcgctggcggtggcc
acgtcgcgcgtgctgctgcaggcggcggggcaggagcccacggcgaaggcgacggcgcgg
ctggcgtgggagatggagcaggagttccacggcacgccgtccggcgtggaccacaccacc
agcgcggaggagaagctcatcctctaccgccgggtgcaggccccggcgggtgtcacgggc
cgcgcgcgcgaattgaagagtccgcggccggtgtccgtggtggtggcgctggcgggcgcg
cgcagtcccacgaagctgacggtgggggcgctgcgcgagcggcaggcgcggtggccggag
cgctacaagcggctcttcggccaggtgggaaggctcgtcaccgaggcggcgaagacggtg
gaggcgggcgacctggaggggctgggggacgcgatgaacgtcaaccagggcctcctgaac
gcgctggggctgtcgtcaccagcgctggaggacatggtgttccggctgcgctcgctgggc
gcgctgggggccaaattcaccggggcgggaggtgacggtggcgcggtcatcggcctcttc
cccgaaccggagcccgtggtcgcgcaactgacgcgtgacggcgtgcgctgcttcgcgagt
cagctcgcggggcctcgggtccagggagacattccatga

DBGET integrated database retrieval system