KEGG   Corallococcus coralloides: COCOR_02449Help
Entry
COCOR_02449       CDS       T01780                                 

Definition
(GenBank) putative phosphomevalonate kinase
  KO
K00938  phosphomevalonate kinase [EC:2.7.4.2]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00900  Terpenoid backbone biosynthesis
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    COCOR_02449
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.2  phosphomevalonate kinase
     COCOR_02449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFE04649
UniProt: H8MPK2
Position
2963652..2964731
Genome map
AA seq 359 aa AA seqDB search
MDRALSAPGKLFISGEYAVLWGGVSRLAAVAPRTAAYVRRRQDSRVHICLEEGTLQGLTT
PRGVKWDREVPAGFSFVARTLDEALRAHGRASVGFDVAVAPGALGPGGHKLGIGGSASAT
VLAAEAARFVLEEKFDVLKLALTAHTLGQGGKGSGGDVATSFAGGAVRYRRYDVTALADA
ANTGRFNAALAESPPVDLWRMPVPRVSMLYAFTGESASTKLLIGQVEARLAEAGRKAYVE
RSDALGHAIENGLGGGDFRAFAEAVKAQHALLLELGPLETEGMRRVLAIAASYHCAGKLS
GAGGGDGCILFAPNAQAREALREGLESRGFLTLTLDVEQGVRGEAQVDARLRGWVDALT
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaccgagcgctctccgccccaggcaagctgttcatctccggtgagtacgccgtgctg
tggggcggcgtgtcgcgtctcgcggcggtggcgccacgcacggccgcctatgtgcgcagg
cgtcaggactcgcgtgtgcacatctgcctggaggaggggacgctccagggcctcaccacg
cctcgcggcgtgaagtgggaccgcgaagtgcccgccggcttctccttcgtcgcccgcacg
ctggatgaagccctgcgcgcgcacggccgcgcgagcgtgggcttcgacgtggcggtcgct
ccgggcgctcttgggcccggcggccacaagctgggcatcggcggcagcgcgtccgcgacg
gtgctcgccgcggaggccgcgcgcttcgtgctggaagagaagttcgacgtcctcaagctc
gccctcaccgcgcacacgctggggcagggcggcaagggcagcggcggcgacgtggccacg
agcttcgctgggggggccgtgcgctaccggcgctacgacgtcaccgcgctcgcggacgcc
gccaacaccggtcgcttcaacgccgcgctcgcggagtccccgccagtggacctctggcgc
atgcccgtgccgcgcgtgtccatgctctacgccttcaccggagagagcgcgtccacgaag
ctcctcatcggtcaggtggaggcccgcctcgcggaggctggccgcaaggcctacgtggag
cgctccgacgcgttgggccatgcgattgagaacggcctgggcggcggtgacttccgcgcc
ttcgccgaagccgtgaaggcccagcacgcgctgctcctggaactgggcccgctggagacc
gaaggcatgcgccgcgtgctggccatcgccgcgtcctaccactgcgcgggcaagctctcc
ggcgcgggcggtggtgacggctgcatcctcttcgccccgaacgcccaggcgcgcgaagcg
ctgcgagaaggcctggagtcgcgtggcttcctcacgctgacactggacgtggagcagggc
gtgcgcggcgaggcgcaggtggatgcgcggcttcgcggctgggtggacgcgctcacgtga

DBGET integrated database retrieval system