KEGG   Corallococcus coralloides: COCOR_02451Help
Entry
COCOR_02451       CDS       T01780                                 

Definition
(GenBank) type I phosphodiesterase/nucleotide pyrophosphatase family protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AFE04651
UniProt: H8MPK4
Position
2966095..2967687
Genome map
AA seq 530 aa AA seqDB search
MRESLNELVSENSRNWANTLVRRIGSKVPPVAARRPRNALLVHLDGVPKALLDEAIVTGR
MPFVSQLVRSGAYHLENAFWGAPTSTPFFQAGLLYGLQHPNLPGYSWYDRALGRKVQMNS
PGDAMAIDARLRGHGRTSLLDHGGHTYFSLFHAGAMNRMCMSTLSSFKLMARSFAYEIEG
LGSARTKSAWNFLRSFGMESWQAMREVRQWARSLNDWRHEQGFLVSRILLQRLGWSFAYT
KSLVDMVRGVPLIYLVYGNYDEVAHRRGPRSELAMQELHRVDASLAELFAVARAAPEPYD
VILLSDHGHVDSLPLEQRQGRRLEAVLFEGEVPPLKDDVRRGLLDGRQPPAPDTAAREPF
IPVVVEAGNFAHIYLSGRPAPLEARELLARHPEVLARATSNPDIGMVAMRRGAEAVVVMG
GGVYGPEELDRAPLTTEYSKRAVADFLHGLPRMDTAGDLVLFGEAVQKGGTVGFAWEFGS
HGGLTRVESDSLVMWPANGPVDLSGLSHCARLHERLAEAYLDTGSPRILH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgaaagtctcaacgagctcgtcagcgagaattcacgaaactgggcgaataccctc
gtccggaggattggttcgaaagttccgcccgtggcggcgcgtcggcctcggaacgctctg
ctcgtccacctggacggtgtgcccaaggcgctcctcgacgaggccattgtcacagggcgc
atgccctttgtttcacagctggtccgctctggcgcgtatcacctggagaacgcattctgg
ggagcgcccacgtccacgccgttcttccaggcggggctgctctacgggctgcaacacccg
aacctgccgggctacagctggtacgaccgggcgctcggccgcaaggtgcagatgaacagc
ccgggcgacgcgatggccatcgacgcgcgcctgcgcggccacggccgcacgagcctcctg
gatcacggcggccacacgtacttctcgctcttccacgcgggcgccatgaaccgcatgtgc
atgagcacgctgtcgagcttcaagctgatggcgcgctcgttcgcgtacgagattgaaggc
ctggggtcggcgcgcacgaagagcgcgtggaacttcctgcgttccttcggcatggagtcc
tggcaggccatgcgcgaggtgcgccagtgggcgcgctcgctcaatgactggcgccacgag
cagggcttcctcgtgagccgcatcctcctccagcggttgggctggagcttcgcgtacacc
aagtccctggtggacatggtgcgcggcgtgccgctcatctacctggtgtacggcaactac
gacgaggtggcccaccgccgcggcccgcgctcggagctggcgatgcaggagctgcaccgg
gtggacgcgtcgctggcggagctgttcgccgtggcccgcgccgcgccggagccctacgac
gtcatcctcctgtcggaccatggccacgtggacagcctgccgctggagcagcgccagggc
cgccgcctggaggccgtcctcttcgagggcgaggtgccgccgctgaaggacgacgtgcgc
cgaggcctgctggatgggcgccagcctccggcgccggacaccgccgcgcgcgagcccttc
atcccggtggtggtggaggccggcaacttcgcccacatctacctgagcggccgtcccgct
ccgctggaggcacgcgagctgctggcgcggcatccggaggtgctggcgcgggccacgagc
aacccggacatcggcatggtggcgatgcgccggggcgcggaggcggtggtggtgatgggc
gggggcgtctacggcccggaggagctggaccgcgcgccgctcaccaccgagtacagcaag
cgcgccgtggcggacttcctccacgggctgccgcgcatggacaccgcgggggacctggtc
ctcttcggtgaagccgtccagaagggcggcacggtgggcttcgcgtgggagtttggctcg
cacggcggcctgacgcgcgtggagtccgacagcctggtgatgtggcccgcgaacggcccg
gtggacctgtccggcctgagccactgcgcgcggctgcacgagcgcctggcggaggcctac
ctggacaccggctcaccgcggattctccattga

DBGET integrated database retrieval system