KEGG   Corallococcus coralloides: COCOR_02454Help
Entry
COCOR_02454       CDS       T01780                                 

Gene name
fdx
Definition
(GenBank) putative 2Fe-2S cluster assembly ferredoxin
  KO
K04755  ferredoxin, 2Fe-2S
Organism
ccx  Corallococcus coralloides
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    COCOR_02454 (fdx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2 Fer2_4
Motif
Other DBs
NCBI-ProteinID: AFE08767
UniProt: H8MPK6
Position
complement(2969034..2969411)
Genome map
AA seq 125 aa AA seqDB search
MPKVTFKSPLAEVAVDVPPGTTLLDAAEKGEAQVGHSCGGVCGCSTCHVWVRKGLDSLSE
QRDDEMDRLDMGFDVRPYSRLSCQTEVGGEDVTVEITEESLVAFMDENPAIRRKLESEGR
WPLKK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaaggtcaccttcaagagccccctggccgaggtcgccgtggacgtgcccccgggc
accaccctgctggacgccgccgagaagggcgaggcccaggtgggccacagctgcggcggc
gtgtgcgggtgctccacctgccatgtctgggtccgcaagggcctggactcgctgagcgag
cagcgggacgacgagatggaccgcctggacatgggcttcgacgtccggccgtactcccgc
ctgtcctgccagacggaggtcggcggcgaggacgtcacggtggagatcaccgaggagtcc
ctggtcgccttcatggatgagaacccggccatccgccggaagctcgagtccgaaggccgc
tggccgctgaagaagtag

DBGET integrated database retrieval system