KEGG   Corallococcus coralloides: COCOR_02480Help
Entry
COCOR_02480       CDS       T01780                                 

Gene name
ruvC
Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
ccx  Corallococcus coralloides
Pathway
ccx03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    COCOR_02480 (ruvC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccx03400]
    COCOR_02480 (ruvC)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     COCOR_02480 (ruvC)
DNA repair and recombination proteins [BR:ccx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     COCOR_02480 (ruvC)
    RecFOR pathway proteins
     COCOR_02480 (ruvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC
Motif
Other DBs
NCBI-ProteinID: AFE10295
UniProt: H8MQT0
Position
2994328..2994909
Genome map
AA seq 193 aa AA seqDB search
MRVLGVDPGSRFMGFGVVEEKKGKLVHLGHGVIKVVESAPLAERLKDLHAALSAALGRYQ
PEAVAVEGLFTHRNARSALVLGHARGVALLAAAQAGLPVHEYAPASVKKSVGASGAGGKD
AVARMVRTLLGVDDATLERADASDALAVAVCHLNQFRVGMPRASAPGNGKRKGAASVLAD
RLSSAYQRPETRR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggtactcggcgtggaccctggcagccgcttcatgggcttcggggtcgtggaggag
aagaagggcaagctcgtgcacctgggccatggcgtcatcaaggtggtggagtccgcgccc
ctcgctgaacgcctgaaggacctgcacgccgccttgagcgccgcgctcgggcgctaccag
ccggaggccgtggccgtggaaggcctcttcacccaccgcaacgcccgcagcgccctggtg
ctggggcatgcgcgcggcgtggcgctgctcgccgcggcgcaggcgggcctgcccgtgcac
gagtacgcccccgccagcgtgaagaagtccgtgggggccagcggcgcgggcggcaaggac
gccgtggcgcgcatggtgcgcacgctgctcggcgtggatgacgcgacactggagcgcgcg
gatgccagcgacgcgctcgccgtcgcggtgtgccacctgaaccagttccgcgtgggcatg
ccccgcgccagcgctcccggcaacggcaagcgcaagggggccgcgtcggtgctcgcggac
cgcctgtcgtccgcctaccagcgcccggagacccgccgatga

DBGET integrated database retrieval system