KEGG   Corallococcus coralloides: COCOR_02483Help
Entry
COCOR_02483       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFE04668
UniProt: H8MQT3
Position
complement(2997295..2998380)
Genome map
AA seq 361 aa AA seqDB search
MISASAPFRPLPLLPEARAERSPGPRLQKLRRAAQEAREAFVREGPVAAVATCDLITFPY
PTLFAFSGAALSPAPYVMMTNRMQVVQFAEAGTGQRRTLLFNPTDYERGHAAPFYRALRE
RYGAFLSDKVMSTRHGTVQGYLEQLGLTPSDVDYLAFDHLHIQDLRGWLGGDGAPPVFPR
ARLLVQRAEWTMVKHLHPMQHVWFVPGGADIPDERVVLLDGDTWLGQGAALLSTPGHTQG
NMSLAVATANEVFVVSENGVSTESYTPLLSRIPGVRRFAEQMGWEVVLNGNTREDSLEQY
ASMVVEKLFAGPSAHDASFVNFHPSSLLTAHLLAPGLGPTVVLPAPNTGGLHPTPALRRA
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatttccgcttctgccccgttccgtcccctgcccctcctgcccgaggcccgcgccgag
cgttcgcccggcccccgtctccagaagctgcgccgcgccgcgcaggaggcccgcgaagcc
ttcgtccgggagggtccggtggcggcggtggccacctgcgacctcatcacgttcccctac
cccacgctgttcgccttcagcggggcggcgctgtcaccggcgccctacgtgatgatgacc
aaccgcatgcaggtggtgcagttcgcggaggccggcaccggccagcggcgcacgctgctc
ttcaaccccaccgactacgagcggggccacgcggcgcccttctaccgcgcgctgcgcgag
cgctacggcgcgttcctctccgacaaggtgatgtccacccgccacggcacggtgcagggc
tacctggagcagctggggctgacgccgtcggacgtggactacctggccttcgaccacctg
cacatccaggacctgcgcggctggctgggcggtgacggcgccccgcccgtgttcccccgg
gcgaggctgctggtgcagcgcgcggagtggaccatggtgaagcacctgcaccccatgcag
cacgtgtggttcgtgcccggcggcgcggacatcccggacgagcgcgtggtgctcctggac
ggcgacacgtggctgggccagggcgcggcgctgctcagcacgcccggccacacgcagggg
aacatgtccctggcggtggccaccgcgaatgaagtcttcgtggtgagcgagaacggcgtg
agcacggagagctacacgccgcttttgtcgcgcatccccggcgtgcgccgcttcgcggag
cagatgggctgggaggtggtgctcaacggcaacacgcgcgaggactcgctggagcagtac
gcgtccatggtggtggagaagctcttcgcgggcccgtccgcgcatgacgcgtcgttcgtg
aacttccacccgtcctcgctgctcaccgcgcacctgctggccccgggcctggggcccacc
gtggtgctgcccgcgccgaacacgggcgggctgcaccccacgcccgcgctgcggcgcgcg
gcgtag

DBGET integrated database retrieval system