KEGG   Corallococcus coralloides: COCOR_02486Help
Entry
COCOR_02486       CDS       T01780                                 

Gene name
lpxC
Definition
(GenBank) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
  KO
K02535  UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC:3.5.1.108]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00540  Lipopolysaccharide biosynthesis
ccx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    COCOR_02486 (lpxC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ccx01005]
    COCOR_02486 (lpxC)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.108  UDP-3-O-acyl-N-acetylglucosamine deacetylase
     COCOR_02486 (lpxC)
Lipopolysaccharide biosynthesis proteins [BR:ccx01005]
 Lipid A
  COCOR_02486 (lpxC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxC
Motif
Other DBs
NCBI-ProteinID: AFE09255
UniProt: H8MQT6
Position
3001489..3002433
Genome map
AA seq 314 aa AA seqDB search
MLQFNDFQRTLSQPAICRGVGLHSGLPVTLTLKPAPAGHGIVFVRTDLARPVSIPALAEY
VVDTSLATTLGRDGVKVGTVEHLMSALAALGIDNVRAELDGPEVPIMDGSAAPFTHAIME
AGSHELDAPREYLVIKKSVAVTDGDKQASLTPARRFRISCTIDFEHPVIQGQSFDVDVND
RGFSREISRARTFGFLRDVEKLKTLGLARGGSLENAVVVDEAAILNPDGLRFPDEFVRHK
ILDAIGDVSLFGRPVIGHMTAFKTGHALNHKLVRKVLADPSSFDIVTARRRDVEGREPGR
ASLAGALELEPLVA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgctccagttcaacgacttccagcgcaccctttcccagccggccatctgccgcggcgtg
gggctccactccgggttgcccgtgacgctgaccctgaagcccgcgcccgcggggcatggc
atcgtcttcgtccgcacggacctggcgcgcccggtgagcatccccgcgctggcggagtac
gtggtggacacgtcgctggccaccaccctgggccgggacggcgtgaaggtgggcacggtg
gagcacctgatgtccgcgctggcggcgctgggcatcgacaacgtgcgcgcggagctggac
gggccggaagtgcccatcatggacggcagcgccgctcccttcacgcacgccatcatggag
gccgggtcgcacgagctggacgcgccgcgcgagtacctggtcatcaagaagagcgtggcg
gtgacggacggcgacaagcaggcctcgctcacccccgcccggcgcttccgcatcagctgc
accatcgacttcgagcaccccgtcatccagggccagtccttcgacgtggacgtgaacgac
cggggcttctcgcgtgaaatctcgcgcgcccgcacgttcggcttcctgcgcgacgtggag
aagctcaagacgctgggcctggcgcgcggtggttcgctggagaacgcggtcgtcgtggac
gaggccgccatcctcaacccggacggcctgcgcttcccggacgagttcgtgcgccacaag
attctggacgccattggcgacgtgtcgctctttggccggcctgtcattggccacatgacg
gcgttcaagacgggccacgcgctcaatcacaagctcgtgcgcaaggtgttggcggacccc
tccagcttcgacatcgtcaccgcgcgccgccgggacgtggaggggcgtgagccgggccgt
gcaagcctcgccggcgcgttggagctggagcccctggtcgcctga

DBGET integrated database retrieval system