KEGG   Corallococcus coralloides: COCOR_02487Help
Entry
COCOR_02487       CDS       T01780                                 

Gene name
nhaA2
Definition
(GenBank) putative lipoprotein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_4 DSBA Thioredoxin_2 SurA_N_3 Thioredoxin_5 SurA_N_2
Motif
Other DBs
NCBI-ProteinID: AFE09595
UniProt: H8MQT7
Position
3002496..3003584
Genome map
AA seq 362 aa AA seqDB search
MRSTRIALAALLAASLTAGCNKEKAPANAQAPAAQAQAANAAEPAPDTVVATYGNNEKVT
FGELNERIKEPLANLDKQKFQLRKRGLEGLVTERLVKAEATKRGITEDQLLKAEIDDKIP
APPEEKIKEVFEGAKGQLPPGATYEQMKPQIVDFLSGQQKQEAAQKFFDSLRAGANVKYE
LPEPPRPPAERKQVAATGPSKGPESAPVTIVEFSDFQCPFCSRAIGTVDEVTKLYGDKVR
LVFRQFPLDFHQQAQKAAEASLCANEQGKFWEMHDKLFANQKALGVDDLKKYAGELKLDT
AKFNTCLDSGATAATVKADMADGSKVGVSGTPAFFINGIMLSGAQPLDEFKSVIDAELKG
AK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctactcgcatcgccctggccgccctcctcgcggcatccctcaccgccggctgc
aacaaggagaaggcgccggccaatgcccaggcgcccgccgcgcaggcccaggccgccaac
gccgccgagccggcgccggacaccgtggtggccacctacggcaacaacgagaaggtcacc
ttcggtgagctcaacgagcgcatcaaggagccgctggcgaacctggacaagcagaagttc
cagctgcgcaagcgcggcctggaagggctcgtcacggagcgcctggtgaaggccgaggcc
accaagcgcggcatcaccgaggaccagctgctcaaggcggagatcgacgacaagatcccc
gcgccgccggaagagaagatcaaggaggtcttcgagggcgccaagggtcagctgcccccg
ggcgcgacctacgagcagatgaagccgcagatcgtggacttcctgtccggccagcagaag
caggaggcggcccagaagttcttcgactcgctccgcgcgggcgccaacgtgaagtacgag
ctgcccgagcccccgcgcccgcccgcggagcgcaagcaggtggccgccacgggcccgtcc
aagggtcctgagagcgcgccggtcaccatcgtggagttcagcgacttccagtgcccgttc
tgcagccgcgccatcggcacggtggacgaggtgacgaagctctacggcgacaaggtgcgc
ctggtgttccgccagttccccctggacttccaccagcaggcgcagaaggccgccgaggcc
tcgctgtgcgcgaacgagcagggcaagttctgggagatgcacgacaagctcttcgccaac
cagaaggcgctgggcgtggatgacctgaagaagtacgcgggcgagctgaagctggacacg
gccaagttcaacacctgcctcgactccggcgcgacggccgcgacggtgaaggcggacatg
gcggacggctccaaggtgggcgtcagcggcacgccggcgttcttcatcaacggcatcatg
ctgtccggcgcgcagcccctggacgagttcaagagcgtcatcgacgcggagctgaagggc
gcgaagtag

DBGET integrated database retrieval system