KEGG   Corallococcus coralloides: COCOR_02490Help
Entry
COCOR_02490       CDS       T01780                                 

Gene name
pepA1
Definition
(GenBank) cytosol aminopeptidase family protein
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00480  Glutathione metabolism
ccx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    COCOR_02490 (pepA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccx01002]
    COCOR_02490 (pepA1)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     COCOR_02490 (pepA1)
Peptidases [BR:ccx01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   COCOR_02490 (pepA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: AFE09778
UniProt: H8MQU0
Position
complement(3005673..3007292)
Genome map
AA seq 539 aa AA seqDB search
MQFSLVSGEAAPVSGELLVIPLFEGELGDSAPAPLTAADSALDGKLRAAATQEGFKGKVD
QSFLVHTLGKLGADRVLLLGLGNRARFQPEVLRLAAGRAAKTAQRLKATAIGFRVPATDD
AALAVRAVVEGLELGVYRFDKYKSAAREDKGSPKLTRATLSLPEGTEKSRALDDALTLGL
KLAEAVNWARDLVNEPPNVVTPTKLAQAAQQAAKEGGLTAEIGGRKEIERLNMGMFLGVT
AGSVQEPRLIHLVYTPKNAKDAKRAPLALVGKAITFDSGGLSLKPTEGMVEMKTDMAGSA
AVLAAMKVIGSVVKPPFPVHAFIGACENMPSGTAYKPGDILTARSGKTVEITNTDAEGRL
VLGDMLTWAGEHEPSAIIDLATLTGACMVALGSYIVGAFGDDDDAVNSVLAAARAAGEEM
WRLPVSDLQKDALRSEVADMKNSGERWGGAINAALFLKEFVGDTPWVHLDIAGPSNSPKE
RGYLNKGGTGVGARTLVELVRRKAAEVASQPEPTKAEAPAKAPKAAKAPKAAKGKPARA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcagtctcgtctccggtgaagccgcgccggtgagcggtgagctgctcgtcatc
cccctcttcgagggcgagctgggtgattccgcccccgcgccgctgacggccgcggattcc
gcgctggacggcaagctgcgcgccgccgccacccaggagggcttcaagggcaaggtggac
cagtccttcctggtgcacaccctggggaagctgggcgcggaccgcgtcctcttgctgggc
ctgggcaaccgcgcgcgcttccagccggaggtgctgcggctggccgcgggccgcgcggcg
aagacggcgcagcggctgaaggcgaccgccatcggcttccgcgtgcccgccacggacgac
gcggcgctggccgtgcgcgcggtggtggagggcctggagctgggcgtctaccgcttcgac
aagtacaagtccgccgcgcgcgaggacaagggcagccccaagctgacccgcgccacgctg
tcgctgccggagggcacggagaagtcgcgcgcgctggacgacgcgctgaccctgggcctg
aagctggcggaggccgtcaactgggcgcgcgacctggtcaacgagccccccaacgtggtg
acgcccacgaagctggcgcaggccgcgcagcaggccgccaaggagggcgggctcaccgcg
gagattggcgggcgcaaggagattgagcgcctgaacatgggcatgttcctgggcgtcacc
gccggcagcgtgcaggagccgcggctcatccacctggtctacacgccgaagaacgcgaag
gacgcgaagcgcgccccgctggcgctggtgggcaaggccatcaccttcgactcgggcggc
ctgtcgctcaagcccaccgagggcatggtggagatgaagacggacatggccgggtccgcc
gcggtgctggcggcgatgaaggtcatcggctccgtggtgaagccgcccttccccgtgcac
gccttcatcggcgcgtgcgagaacatgccgtccggcacggcgtacaagcccggtgacatc
ctcaccgcgcgctccggcaagacggtggagatcaccaacacggacgcggagggccgcctg
gtgctgggtgacatgctcacctgggccggcgagcacgagccgtccgccatcatcgacctg
gcgacgctcacgggcgcgtgcatggtggcgctgggcagctacatcgtgggcgccttcggc
gacgacgacgacgcggtgaacagcgtgctcgccgccgcgcgcgccgcgggcgaggagatg
tggcgcctgcccgtcagcgacctgcagaaggacgcgctgcgctccgaagtggcggacatg
aagaactccggcgagcgctggggcggcgccatcaacgcggccctcttcctcaaggagttc
gtgggcgacacgccctgggtgcacctggatatcgccggtccgtccaacagccccaaggag
cgcggctacctcaacaagggcggcacgggcgtgggcgcgcgcacgctggtggagctggtg
cgccgcaaggccgcggaagtggcctcgcagccggagcccaccaaggccgaggctcccgcg
aaggccccgaaggccgccaaggccccgaaggccgccaagggcaagccggcccgcgcgtag

DBGET integrated database retrieval system