KEGG   Corallococcus coralloides: COCOR_02491Help
Entry
COCOR_02491       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_dep_PLPC
Motif
Other DBs
NCBI-ProteinID: AFE04672
UniProt: H8MQU1
Position
3007431..3008327
Genome map
AA seq 298 aa AA seqDB search
MPTLLLHLTAIERLAAHPDGLPADWVRALSEDLPYARFGAALPDLPLCAGVRGGLGVMMQ
PEAGWPLFARLYHERAPVGLGLKMAELVASGALVGTEAGLAILAGYFTHLSLDRRLHPLV
DQLVLRHRRKGERAWDARRQVEWAQTLFFLRQQDGTDGVGTARIREKFQVVKSSGIPLRG
IGRGIYELVRLASQDRVGQAPTKAELDGWVRGLYVSGLFLSSPLGRMRALPAYSQLSFQE
LYRNDHFDFAVELDAALEVTRGLIRRLHGYMTRGTYTPRTRARFLEEFPEGTLGATAA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccctgctgctgcatctgacggccatcgaacggttggccgcccatccggacggc
ctccccgccgactgggtgcgcgccttgtccgaggacctgccgtacgcgcgcttcggcgcg
gcgctgccggacctgccgctgtgcgccggcgtgcgcgggggcctgggcgtgatgatgcag
ccggaggccggctggcccctcttcgcgcggctgtaccatgagcgcgccccggtgggcctg
ggcctgaagatggcggagctcgtcgcctcgggcgccctcgtgggcacggaggcgggcctg
gccatcctcgcggggtacttcacgcacctgagcctggaccggcgcctccacccgctggtg
gaccagctggtgctgcgccaccgccgcaagggcgagcgggcctgggacgcacggcgtcag
gtggagtgggcccagacgctcttcttcctgcgccagcaggacggcacggatggcgtgggc
accgcccgcatccgcgagaagttccaggtggtgaagagctccggcatcccgctgcgaggc
attggccggggcatctacgagctggtgcgcctggcgtcgcaggaccgcgtgggacaggcc
cccaccaaggcggagctggatggctgggtgcgcgggctctacgtctccgggctcttcctc
tccagtccgctcggccgcatgcgggcccttccggcgtactcacagctctccttccaggag
ctgtaccgcaatgatcactttgacttcgcggtggagctggacgccgcgctggaagtgacg
cgcggactgattcgcagactgcacggctacatgacgcgcggcacctacacgccgcgtacg
cgcgcgcgcttcctggaggagtttccagagggaacgctgggcgccaccgccgcgtag

DBGET integrated database retrieval system