KEGG   Corallococcus coralloides: COCOR_02493Help
Entry
COCOR_02493       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1634 DUF4538
Motif
Other DBs
NCBI-ProteinID: AFE04674
UniProt: H8MQU3
Position
3009277..3009714
Genome map
AA seq 145 aa AA seqDB search
MMVPEAGPPRRNAQATSVALDGEFHEELPQEPITQPEVLPRERRGARRLAAGERWIARML
RTGAITSGCMFVTSLALELLPRDESVHVAIDLLRKGAASMLLVTPVARLAMAGTLLGLRG
EWRYAAIAAGVIGLLALAVGAGFQA
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgatggttccggaggcaggacccccacgtcgcaacgcgcaggcgacgtcggtggcgttg
gatggggagttccacgaggagctcccgcaggaacccatcacccagccggaggtgctccct
cgtgagcgccggggggcccggaggctcgccgccggggaacgatggattgcccgaatgctg
cgcaccggggccatcaccagtggctgcatgttcgtcacgtcgctcgcgctggagttattg
ccacgcgacgagtccgtgcacgtggccatcgacctgttgcgcaagggcgcggcgtccatg
ctgctggtgacgccggtggcgcggctggcgatggcgggaacgctgctgggcctgcgcggc
gagtggcgttacgccgccatcgccgcgggtgtcatcgggttgctcgcgctggcggtgggc
gcgggcttccaggcctga

DBGET integrated database retrieval system