KEGG   Corallococcus coralloides: COCOR_02494Help
Entry
COCOR_02494       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_12 TPR_2 TPR_16 SNAP TPR_10 TPR_MalT CdiI_2
Motif
Other DBs
NCBI-ProteinID: AFE04675
UniProt: H8MQU4
Position
complement(3009750..3010619)
Genome map
AA seq 289 aa AA seqDB search
MHPSDNERAHITDAIQKQKNALAPLRITGSPSEVGQGLVALAELYGMLEDHAASREHYEE
AFGFFKTAGNKPGQAQALFGLGVVKAHFEDHKGAIEHMATAALLFNEARDREGEALTRAC
IGESLRAMGEADGAEEKYQEALILYRQTRNNERIARLLLDIGDLRMAKGEYEPARKRFLE
AVPLLEQGEDPEALALGHLLLGESEGLLGHHDNARPHLLRAVDVYGELHDHVYEARARWD
LGLSCYYLQDYAAAREQFEAVLPMYEDLKQHDEVAKVKNVLAHFAARGV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcacccgtccgacaacgaacgcgcccacatcaccgacgccatccagaagcagaagaac
gcgctcgccccgctgcgcatcaccggctcaccctccgaggtgggccaggggctggtggcg
ctggcggagctgtacgggatgctggaggaccacgcggcgagccgcgagcactatgaagag
gccttcggcttcttcaagaccgcgggcaacaagcccggccaggcgcaggcgctcttcggc
ctgggcgtggtgaaggcccacttcgaggatcacaagggcgccatcgagcacatggccacc
gccgccctgctcttcaacgaggcgcgcgaccgcgagggcgaggcgctcacccgcgcctgc
atcggcgagtccctgcgcgccatgggcgaggccgacggcgccgaggagaagtaccaggag
gcgctcatcctctaccgccagacgcgcaacaacgagcgcatcgcgcggctgctgctggac
attggcgatctgcgcatggccaagggcgagtacgagcccgccaggaagcgcttcctggag
gccgtgccgctcctggagcagggcgaggatccggaggcgctcgcgctggggcacctgctg
ttgggggagtccgagggcctgctgggccaccacgacaacgcgcggccgcacctgctgcgc
gcggtggacgtgtacggagagctgcacgaccacgtctacgaggcccgcgcgcgctgggac
ctggggctgtcctgctactacctccaggactacgccgcggcccgcgagcagttcgaggcc
gtgctgcccatgtacgaggacctgaagcagcacgatgaagtggcgaaggtgaagaacgtc
ctcgcgcacttcgccgcgcgcggcgtgtag

DBGET integrated database retrieval system