KEGG   Corallococcus coralloides: COCOR_02498Help
Entry
COCOR_02498       CDS       T01780                                 

Definition
(GenBank) TetR family transcriptional regulator
  KO
K16137  TetR/AcrR family transcriptional regulator, transcriptional repressor for nem operon
Organism
ccx  Corallococcus coralloides
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccx03000]
    COCOR_02498
Transcription factors [BR:ccx03000]
 Prokaryotic Type
  Helix-turn-helix
   TetR/AcrR family
    COCOR_02498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N
Motif
Other DBs
NCBI-ProteinID: AFE04678
UniProt: H8MQU8
Position
3014406..3015107
Genome map
AA seq 233 aa AA seqDB search
MRYTAEHKQATHARILAAAEMLFRAEGFSGASVERVMRAAGLTVGGFYAHFTSKESLLAE
SLRAFMTARRTPWLAGLEGMRGPAFLDRFARRYLDQYNRDTGDTTCMMPSLLSDLTRAAP
EVQAAFAQGLEDLVGQAQTHLPAREGATPRQQMLATVTLCFGAMTLARATASQPLAAEIL
DAARALLVAGAPVEGSARNDAPRAHAAPRRVPASRKKAPSRKRQVGSARKKPL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacaccgctgaacacaagcaggccacgcacgcgcgcatcctcgcggcggcggag
atgctgttccgcgcggagggcttcagcggtgcgagcgtggagcgggtgatgcgggccgcg
ggcctgacggtgggcggcttctatgcccacttcacctccaaggagtcgctgctcgcggag
tcgctgcgcgccttcatgacggcgcgcaggacgccctggctcgcggggctggaggggatg
cggggcccggcgttcctggatcgcttcgcgcggcgctacctggaccagtacaaccgggac
acgggcgacacgacctgcatgatgccgtcgctcctgtcggacctgacgcgcgcggcgccg
gaggtgcaggccgcgttcgcccaggggctggaggacctggtcggccaggcccagacgcac
ctgcccgcgcgcgagggcgccacgccccggcagcagatgctggcgacggtgacgctgtgc
ttcggcgcgatgacgctcgcgcgggccaccgcgtcccagccgctggcggcggagatactg
gacgcggcgcgtgcgctgctcgtcgcgggggctcccgtggaggggagcgccaggaatgac
gcgcctcgcgcgcacgcggcgccgcgcagggttcccgcctcgcgcaagaaggcgccctcc
cggaagcgccaggtgggctccgcgcgcaagaagcccctctga

DBGET integrated database retrieval system