KEGG   Corallococcus coralloides: COCOR_02912Help
Entry
COCOR_02912       CDS       T01780                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP NTP_transf_3 DUF4301
Motif
Other DBs
NCBI-ProteinID: AFE04913
UniProt: H8MYQ3
Position
3608043..3609182
Genome map
AA seq 379 aa AA seqDB search
MKTQTPDVDGELDDPRLARDGFDAASFRALLARYQRGELTESQSLAGPLEPPRPGDVQPL
PGEGTPAHEACRAVGEQAFREGAVAALVVAGGAGTRFGGVVKGLVPVLGEHTFLDLKLAE
ARRLGERLGRPVPVAVMTSFLTHEAIAAHLEARGLGRDVFLFRQQMLPRLTPEGALFREA
DGQLSFAPSGHGDVFRALRESGVGQTLRQRGVRCMYFSNVDNLAATLDPVVIGMHLQRGC
DMTVEVTPRANPSGALDAGAAPVRVGGQLQLVEKVDPTQHAFISTNNITFQLEAMLNEAL
PIPYRVVPKKVDGAPVLQFEQVTAEASSLTRPDGQPLLSVAFIEVGRTDPATSRFEPVKA
PDDLPRVVERLRSRLVALR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacccagaccccggatgtggatggagaacttgatgacccccggctcgcgcgtgac
ggcttcgacgcggccagcttccgggcgctgctcgcccgctaccagcgcggggagttgacg
gagtcccagtccctggcgggccccctcgaaccgccacggccgggggatgtccagccgctg
ccgggcgagggcacccctgcccacgaagcctgccgtgcggtgggggagcaggccttccgc
gagggcgcggtggccgccctggtggtggccggtggagcggggacacgttttggcggggtc
gtgaaggggctggtccccgtcctgggggagcacaccttcctggacctcaagctcgccgag
gcgcgccggttgggcgagcggctgggccgcccggtgccggtggcggtgatgacctccttt
ctcacgcacgaggccatcgccgcgcacctggaagcccgggggctggggcgggacgtgttc
ctcttccggcagcagatgcttccccggctcacgccggagggcgccttgttccgggaggcg
gatgggcagctgtcctttgccccttctggccacggggacgtgttccgcgccctgcgcgag
agcggggtggggcagacgctgcgccagcgcggtgtgcgctgcatgtacttctccaacgtg
gacaacctggcggcgacgctcgacccggtcgtcatcgggatgcacctgcaacggggctgc
gacatgacggtggaggtgacgccgcgggccaaccccagtggcgcgctggacgcgggcgcc
gcgccggtgcgcgtgggcggccagctccagctcgtggagaaggtggaccccacgcaacat
gccttcatctccaccaacaacatcaccttccaattggaggccatgctgaacgaagcgctg
cccattccctaccgggtggtgcccaagaaggtggacggcgcgcccgtcctccagttcgag
caggtgacggcggaggccagcagcctcacccgaccggatggccagccgctcctgtcggtc
gccttcatcgaggtggggcgcacggaccccgcgacgagccgcttcgaaccggtgaaggcc
ccggatgaccttccccgggtggtggagcgcctgcggtcgcggctggtggccctgcgttag

DBGET integrated database retrieval system