KEGG   Corallococcus coralloides: COCOR_03547Help
Entry
COCOR_03547       CDS       T01780                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00790  Folate biosynthesis
ccx01100  Metabolic pathways
Module
ccx_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    COCOR_03547 (folP)
Enzymes [BR:ccx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     COCOR_03547 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF561
Motif
Other DBs
NCBI-ProteinID: AFE08814
UniProt: H8MLY4
Position
4379418..4380641
Genome map
AA seq 407 aa AA seqDB search
MLRARLISRDRPDDLSLVLRRLNLSPRNREHLTRELGSAHVLVTGGRPSYEEELVPPYGS
KEREKLPTWTPGGHVDHPGEVLLSGSRQQFDRLISLARKSPRTDGLARVLEEVLSPAPLP
ALTLSGRRFEWGTRTYLMGVVNVTPDSFSDGGSFPDAASAVEHALRLVDAGADILDVGGE
STRPGSLPVSAEEELARILQVVEGIKRRSTVPISVDTTKAAVAKEALKAGAHLINDITGF
HSDPALAGVVAAAGAACCLMHTQGMPKTMQEAPRYQDVVGEVMDYLEEGMFQATEAGIPR
ERILLDPGIGFGKTLEHNLFLLRRLEELRGLGQPLLVGTSRKSFLGKLTGGKGPQERLAA
TLGSVAAMAVLGGADVVRVHDVGETRDALAVADAIRRARGGGDLYGG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcgcgcacgcctcatctcccgcgaccgtcccgacgacctgtcgctggtcctccgc
cgcctgaacctgtccccccgcaaccgcgaacacctgacgcgcgagctgggctccgcgcac
gtgctcgtcaccgggggccgtccctcctacgaggaggaactggtgccgccgtacggctcc
aaggagcgggagaagctgcccacctggacgccgggcggacatgtggaccatcccggcgag
gtgctcctgtccggcagccgccagcagttcgaccggctgatctcgctcgcccgcaagtcg
ccgcgcacggatggcctggcgcgcgtgctggaggaggtgctgtcccccgcgcccctgccg
gcattgacgctgagcgggcgccggttcgagtggggcacgcgcacgtacctcatgggcgtg
gtgaacgtgacgccggacagcttctccgacggcggcagcttcccggacgcggccagcgcc
gtggagcatgcgctgaggctggtggacgcgggcgcggacatcctcgacgtgggcggtgag
tccacccggccgggctcgctcccggtgtccgcggaggaggagctggcgcgcatcctccag
gtggtggagggcatcaagcgccgctccaccgtgcccatctccgtggacaccacgaaggcg
gcggtggcgaaggaggcgctcaaggccggcgcccacctcatcaacgacatcaccggcttc
cactcggacccggcgctggccggcgtggtggccgccgcgggcgccgcgtgttgcctcatg
cacacccagggcatgccgaagacgatgcaggaggcgccccgctaccaggacgtggtgggc
gaggtgatggactacctggaggaggggatgttccaggccaccgaggccggcatcccccgc
gagcgcatcctcctggacccgggcatcgggttcggcaagacgctggagcacaacctcttc
ctcctgcgccgcctggaggagctgcgggggttggggcagcccctgctggtgggcaccagc
cgcaagtccttcctcgggaagctgacgggcggcaagggcccccaggagcgcctggcggcc
accctgggctccgtggcggccatggccgtcctggggggcgcggacgtggtgcgggtgcac
gacgtgggggagacgcgggacgcgctggccgtggcggacgccatccggagggcccggggc
ggcggcgacctgtacggcggctga

DBGET integrated database retrieval system