KEGG   Corallococcus coralloides: COCOR_03616Help
Entry
COCOR_03616       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ccx  Corallococcus coralloides
Pathway
ccx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    COCOR_03616
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ccx02022]
    COCOR_03616
Two-component system [BR:ccx02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   COCOR_03616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HEAT_EZ
Motif
Other DBs
NCBI-ProteinID: AFE05330
UniProt: H8MNA2
Position
complement(4484741..4485151)
Genome map
AA seq 136 aa AA seqDB search
MHGKILLLDSKPPVRGATARHLTAAGFTVLTARTDAQARSLLDTNLFDAVLIDHPFGRPG
MEEGLRFARDLRLQDSHVPILLMTALPLDEVRHSAWSSGITKLLPKPQLMPVLILHLSAL
IPAAANEDQPQPIPMR
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgcacggtaaaatcctcctcctcgattcgaagcccccggttcgtggtgcgacggcacgt
cacctgacggccgcgggcttcaccgtcctcaccgcgcgcacggatgcccaggctcgcagc
ctgctggacacgaacctgttcgacgcggtcctcatcgaccatcccttcggccggcccggc
atggaggaaggtctgcggttcgctcgcgacctgcgcctgcaggactcgcacgtccccatc
ctgctgatgacggcgctgcccctggacgaggtccggcactctgcatggagcagcggcatc
accaagctgctgcccaaaccgcagctgatgccggtgctcatcctccacctgtccgcgctc
atccccgccgcggccaacgaggaccagccccagcccatccccatgcggtga

DBGET integrated database retrieval system